[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD31313.1


[Show Plain Result]

## Summary of Sequence Search
   1::366
 183::340  PF00534 0.0% 25.4901960784314  Glycosyl transferases group 1 
   1::366


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKRFVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKVYTLNLNKFNVLFVL
PF00534         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FKYIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLNAKFSKFS
PF00534         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIARNHADKNIS
PF00534         ------------------------------------------ekrkklgknekkkiilsvgrlekeKgvd


                         -         -         -         +         -         -         -:280
query           RFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLDLYLSTSKVEGF
PF00534         llikafallkeqenpnlklvivGdgeeekelkklaeelelsdnvifvgevpredleelyrnadifvlpsr


                         -         *         -         -         -         -         +:350
query           PNILAEAMLCEVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVMKKRMREYIINNFSI
PF00534         sEgfGivllEAmaaglpviasnvggpaeivkdgvtGllvkpkdaealaeaiekllkde..----------


                         -         -         -         -         *         -         -:420
query           EAILEKHEKLYHEGSV------------------------------------------------------
PF00534         ----------------------------------------------------------------------