[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD31359.1


[Show Plain Result]

## Summary of Sequence Search
   1::249
  16::226  PF00696 0.0% 30.8823529411765  Amino acid kinase family 
   1::249


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNDSSECSQKLPKLKRILLKLSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGG
PF00696         ---------------kriVvKlGGsslt.dkg......elkriaeqiakleedgkklvvVsGggsftdkl


                         -         -         *         -         -         -         -:140
query           RANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLI
PF00696         lsalgvekggkagerstklktglvaeaqavaslnqdglldevvsagerlsaplvalllkaggisavqrda


                         +         -         -         -         -         *         -:210
query           FAGGTGNPFVTTDTTASLRAVEIGADALLKATTVNGVYDKDPNKYSDAKRFDKVTFSEVVSKELNVMDLG
PF00696         evesndvealkelleegkvpvltGfigedddgetttlgrgssDtlaallAaalgAdklilltdVdGvyta


                         -         -         -         +         -         -         -:280
query           AFTQCRDFGIPIYVFDLTQPNALVDAVLDSKYGTWVTLD-------------------------------
PF00696         dPkkvpdakllpeisv------------------------------------------------------