[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD31463.1


[Show Plain Result]

## Summary of Sequence Search
   1::1290
 431::589  PF02769 0.0% 29.7297297297297  AIR synthase related protein, C-terminal domain 
 836::962  PF02769 0.0% 25.1968503937008  AIR synthase related protein, C-terminal domain 
  48::74   PF00586 0.0% 33.3333333333333  AIR synthase related protein, N-terminal domain 
 256::389  PF00586 0.0% 50.5263157894737  AIR synthase related protein, N-terminal domain 
   1::1290


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MITIFEGLSALSPFKREKILAAAKKISNKVESVSAQYIHVTELESELNSEQERIVKSLLNYNREYGIAQP
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         -----------------------------------------------peeleeiveGladacnefgvplv
PF00586         -----------------------------------------------peeleeiveGladacnefgvplv


                         -         -         *         -         -         -         -:140
query           MGHTFIIAPRVGTISPWSSKATDIIKNTGIKAVKRIERAILFGVEGQVSASELKQIQDIVHDRMVEEVFS
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         gGdt------------------------------------------------------------------
PF00586         gGdt------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           CKDDLYRLFSVTAPKELEFVNVLEKGAQAIKEADRKLGLALSEQEIEYLADEYTKLGRNPTDTELYMFAQ
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ANSEHCRHKIFNAKWTIDGQEQDKSLFKMIRNTTEKSPQGVLSAYKDNAAVIEGATAQRFYPNTQTGVYS
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ---------------------------------------------gddaavielg...............
PF00586         ---------------------------------------------gddaavielg...............


                         -         *         -         -         -         -         +:350
query           FNQEEVDILMKVETHNHPTAIAPFSGSATGVGGEIRDEGATGLGAKPKAGLTGFTVSNLNIPGFEQAWET
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         kdeelvvttdkvethnhptaidpydgaatavagnlrDia..amGAkplalldglalsnlldpee......
PF00586         kdeelvvttdkvethnhptaidpydgaatavagnlrDia..amGAkplalldglalsnlldpee......


                         -         -         -         -         *         -         -:420
query           SKYGKPNHIVTPLQIMLEAPIGGAHYSNEFGRPNLNGYFRTYEQEVNTSAGKEMFGYHKPIMIAGGMANI
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ................leeiveGladacnefgvplvgGd-------------------------------
PF00586         ................leeiveGladacnefgvplvgGd-------------------------------


                         -         -         +         -         -         -         -:490
query           KRMHVEKGDIKVGAKLICLGGPAMRIGLGGGAASSVVSSDTNSELDFASVQRDNAEMERRCQEVIDRCWQ
PF02769         ----------kpGdvliltgs....lglggsgtslkrkllessglp....qlgdallektliyvvqalaa
PF02769         ----------kpGdvliltgs....lglggsgtslkrkllessglp....qlgdallektliyvvqalaa
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           MGENNPITFIHDVGAGGISNAFPELVKDGGGGGYFELRKVNVGEEGLSPLEIWSNESQERYVLSVDPESL
PF02769         e...glvkaahDitgGGLlgalaemafasgvgaeidldevplfeelelelemlfsensGrllvvvppeda
PF02769         e...glvkaahDitgGGLlgalaemafasgvgaeidldevplfeelelelemlfsensGrllvvvppeda
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           ELFEQLCNRERCPFAVVGEAISEKHITLNDEYFDNKPVDLPMGLLFGNTPQMHIDVKTVKVEQQAFDTSA
PF02769         eavlalleeeglheaaviGevtdkneltl-----------------------------------------
PF02769         eavlalleeeglheaaviGevtdkneltl-----------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           IKLDEAIERVLKVPAVASKSFLITIGDRSITGMVARDQMVGPWQVPVADCAVTTATVDSQAGEAMAMGER
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           TPVAAINAAASGRLAIAETVTNLLAADIEKLSDIRLSANWMVAANQGDENQKLYETVRAVGMEFAPALGI
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           AIPVGKDSMSMKTKWSDNGQAKSVTSPLSLVISGFSPVTNARKTLTPVLVDDNDTTLLHIDLSNGAGRLG
PF02769         -----------------------------------------------------------------lglgg
PF02769         -----------------------------------------------------------------lglgg
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           ASCLAQAYNQVGNVAPDIEASKVKVLFENITKLKAENKILAYHDVSDGGVFATLAEMSFAGRKGLDVKLQ
PF02769         sgtslkrkllessglpqlgdallektliyvvqalaaeglvkaahDitgGGLlgalaemafasgvgaeidl
PF02769         sgtslkrkllessglpqlgdallektliyvvqalaaeglvkaahDitgGGLlgalaemafasgvgaeidl
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           TQDVLAKLFAEEVGVVIQVRNSDVSLVEEMFKDTQIHLCAIAKLNSSDELNIFANGEKTYSNTRVNLQRW
PF02769         devplfeelelelemlfsensGrllvvvppedaeavlalleeeglheaaviG------------------
PF02769         devplfeelelelemlfsensGrllvvvppedaeavlalleeeglheaaviG------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           WAETSYQIQSIRDNSECAKQEFDSILNTNDKGIHVEATFDLEEDITAKFVNVEKPKVTILREQGVNGQVE
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           MAAAFTTAGFEAHDVHMSDLHAGRVTLADFKVLVACGGFSYGDVLGAGGGWAKNILFTEKLRDEFSRFFG
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           RDDTLALGVCNGCQMLAQLKSLIKGAENWPIFIKNKSEQFEARVSMVEIQESDSIWFADMACTKAPIAVA
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           HGEGRPLFENDNQQQAMLASAQVALKYIDGQGQATEMYPYNPNGAVNGLTAVTALDGRVLAMMPHPERVY
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:1330
query           RAITNSHIPAEYDEYSVWMRMFRNARKWVG----------------------------------------
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------