[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD31468.1


[Show Plain Result]

## Summary of Sequence Search
   1::443
  77::337  PF01136 0.0% 47.1615720524017  Peptidase family U32 
 418::443  PF01136 0.0% 23.0769230769231  Peptidase family U32 
   1::443


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKRPELLSPAGTLKAMRYAFAYGADAVYIGQPRYSLRARNNEFSKLEILETATTEAHAQGKKIMLANNIA
PF01136         ----------------------------------------------------------------------
PF01136         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PHNAKIKTYIKDITPVIALKPDAMIMSDPGMIMLVREHFPDQEIHLSVQANAVNYETVRFWQKFGIKRVV
PF01136         ------kelreyleklaelgvdavivadpgvlelarekapdlpihlstqanvtnseavrflkelGakrvv
PF01136         ------kelreyleklaelgvdavivadpgvlelarekapdlpihlstqanvtnseavrflkelGakrvv


                         +         -         -         -         -         *         -:210
query           LSRELSLKEIAEIKENVPDMEIETFVHGSLCMAYSGRCLLSGYYSHRDPNQGVCNNACRNNYKVAEAKQN
PF01136         larelsleeikaiaekvpdvelEvfvhGalclaysgrcllssylggrsanrgsCaqpcrkpyg.......
PF01136         larelsleeikaiaekvpdvelEvfvhGalclaysgrcllssylggrsanrgsCaqpcrkpyg.......


                         -         -         -         +         -         -         -:280
query           EWGDFEPIQTQSTLGIGTPSDKVVLIENDKEPGQYNPMFEDEHGTYIMNSKDLRAIQHVETMMKMGVDCF
PF01136         .........................lieeertgeeepeeedengtyilspkdlclleelpelleaGvdsl
PF01136         .........................lieeertgeeepeeedengtyilspkdlclleelpelleaGvdsl


                         -         *         -         -         -         -         +:350
query           KIEGRTKSFFYAARTAQLYDQAIKDALAGKPFDMTLMDKLEGLAHRGYTEGFYRRHVHDEYQKYDNSDSR
PF01136         KIeGrmksaeyvaevvkaYrkaidallagreeekeelkeeleelanrglttgfllgr-------------
PF01136         KIeGrmksaeyvaevvkaYrkaidallagreeekeelkeeleelanrglttgfllgr-------------


                         -         -         -         -         *         -         -:420
query           SSTQQFVGEITNFDAHTGYADVNVRNKIKIGDSIELMLPSGSREIILDNMQDKDGKHMEEAKGSGYQAKI
PF01136         -------------------------------------------------------------------ael
PF01136         -------------------------------------------------------------------ael


                         -         -         +         -         -         -         -:490
query           KFDNVTAEDMKFALMIKNKSPNI-----------------------------------------------
PF01136         gvdavivadpgvlelarekapdl-----------------------------------------------
PF01136         gvdavivadpgvlelarekapdl-----------------------------------------------