[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30141.1


[Show Plain Result]

## Summary of Sequence Search
   1::248
  27::242    2e-22 27.4% 0050003 00500031 1/1   inked oxidoreductases                   
  29::243  1.1e-19 23.4% 0051899 00518991 1/1   inked oxidoreductases                   
  27::244  1.3e-18 27.0% 0049708 00497081 1/1   inked oxidoreductases                   
  29::242  5.5e-17 24.9% 0052481 00524811 1/1   inked oxidoreductases                   
  54::247  3.1e-16 25.5% 0047140 00471401 1/1   inked oxidoreductases                   
  27::240  1.1e-15 26.1% 0036258 00362581 1/1   inked oxidoreductases                   
 107::244  1.4e-15 26.5% 0046721 00467211 1/1   inked oxidoreductases                   
  27::228  5.1e-14 24.7% 0046599 00465991 1/1   inked oxidoreductases                   
   9::247  1.3e-11 20.1% 0048029 00480291 1/1   inked oxidoreductases                   
  66::244  1.5e-10 25.1% 0039992 00399921 1/1   ose-phoshate binding barrel             
  80::248  5.7e-10 23.4% 0041152 00411521 1/1   ase                                     
 171::244  1.2e-08 31.9% 0049146 00491461 1/1   ose-phoshate binding barrel             
  92::242  2.4e-08 21.1% 0050135 00501351 1/1   inked oxidoreductases                   
 162::238  4.1e-08 31.5% 0041658 00416581 1/1   ase                                     
 179::238  7.7e-08 28.3% 0045712 00457121 1/1   ose-phoshate binding barrel             
 180::244  8.3e-08 28.6% 0049739 00497391 1/1   like                                    
 134::247  1.1e-07 25.7% 0047026 00470261 1/1   inked oxidoreductases                   
 171::246  1.3e-07 32.0% 0049674 00496741 1/1   ose-phoshate binding barrel             
  75::244    2e-07 24.5% 0044760 00447601 1/1   inked oxidoreductases                   
 148::246  2.2e-07 27.6% 0049629 00496291 1/1   ose-phoshate binding barrel             
 171::245  3.8e-07 35.1% 0052714 00527141 1/1   ose-phoshate binding barrel             
 171::248  5.2e-07 30.3% 0047101 00471011 1/1   ose-phoshate binding barrel             
 107::228  5.8e-07 23.9% 0049848 00498481 1/1   ase                                     
 170::244    7e-07 35.1% 0049228 00492281 1/1   ose-phoshate binding barrel             
 167::243  8.3e-07 31.9% 0052610 00526101 1/1   inked oxidoreductases                   
  86::248  1.2e-06 20.9% 0049587 00495871 1/1   inked oxidoreductases                   
  83::244  1.9e-06 24.2% 0051598 00515981 1/1   ose-phoshate binding barrel             
 171::247  2.3e-06 33.3% 0049675 00496751 1/1   ose-phoshate binding barrel             
  79::244  3.4e-06 21.7% 0052356 00523561 1/1   ose-phoshate binding barrel             
 140::244  5.5e-06 25.8% 0048998 00489981 1/1   ose-phoshate binding barrel             
  74::244    8e-06 19.9% 0036628 00366281 1/1   ose-phoshate binding barrel             
 109::244  9.2e-06 18.8% 0045046 00450461 1/1   in phosphate synthase                   
 182::242  1.2e-05 29.3% 0051442 00514421 1/1   ose-phoshate binding barrel             
 185::247  1.2e-05 34.4% 0038072 00380721 1/1   ose-phoshate binding barrel             
 171::247  1.3e-05 33.3% 0050201 00502011 1/1   inked oxidoreductases                   
 180::242  2.6e-05 29.5% 0051164 00511641 1/1   ose-phoshate binding barrel             
  77::246  3.4e-05 14.9% 0044928 00449281 1/1   ephosphate isomerase (TIM)              
 174::238    9e-05 28.1% 0048294 00482941 1/1   ase                                     
 178::242    9e-05 23.4% 0048768 00487681 1/1   ose-phoshate binding barrel             
 171::248  0.00012 24.3% 0047889 00478891 1/1   ose-phoshate binding barrel             
 160::244  0.00016 33.3% 0047125 00471251 1/1   ose-phoshate binding barrel             
 106::246  0.00021 24.0% 0039781 00397811 1/1   ose-phoshate binding barrel             
 109::244  0.00035 18.7% 0049721 00497211 1/1   like                                    
 170::247  0.00045 30.0% 0038429 00384291 1/1   inked oxidoreductases                   
   1::248


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQNQDLKRIIISPPFGKYLKFKETSNVYGSFTVNRRWGLIKQAIKTIRKIDKNAWRNKIGLRNPGLANTN
00500031   1/1  --------------------------elgtvtpdpqagnptprl..arlaedagginrlglnnlgldavl
00518991   1/1  ----------------------------DlstellglklknPiglApmgvskdaeaiaalaagglGiiel
00497081   1/1  --------------------------lnlldlralalrrllrpllfyldgetahrltlaflrigllprvl
00524811   1/1  ----------------------------lLsttllglklknPlglaaglvdkdaeailalaalgfgiiel
00471401   1/1  -----------------------------------------------------glinrmglnnlgleall
00362581   1/1  --------------------------evgtvtpdpqagnpvprla..rlralagginrmglnnlgldall
00467211   1/1  ----------------------------------------------------------------------
00465991   1/1  --------------------------pkdvpllstlilglklknPiilApmadvtdaelaaalalagggg
00480291   1/1  --------delllllglrllyllelllpelrqylsladleelafrrlprslfdyldggaddeltlgrnla
00399921   1/1  -----------------------------------------------------------------mlakr
00411521   1/1  ----------------------------------------------------------------------
00491461   1/1  ----------------------------------------------------------------------
00501351   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00457121   1/1  ----------------------------------------------------------------------
00497391   1/1  ----------------------------------------------------------------------
00470261   1/1  ----------------------------------------------------------------------
00496741   1/1  ----------------------------------------------------------------------
00447601   1/1  ----------------------------------------------------------------------
00496291   1/1  ----------------------------------------------------------------------
00527141   1/1  ----------------------------------------------------------------------
00471011   1/1  ----------------------------------------------------------------------
00498481   1/1  ----------------------------------------------------------------------
00492281   1/1  ----------------------------------------------------------------------
00526101   1/1  ----------------------------------------------------------------------
00495871   1/1  ----------------------------------------------------------------------
00515981   1/1  ----------------------------------------------------------------------
00496751   1/1  ----------------------------------------------------------------------
00523561   1/1  ----------------------------------------------------------------------
00489981   1/1  ----------------------------------------------------------------------
00366281   1/1  ----------------------------------------------------------------------
00450461   1/1  ----------------------------------------------------------------------
00514421   1/1  ----------------------------------------------------------------------
00380721   1/1  ----------------------------------------------------------------------
00502011   1/1  ----------------------------------------------------------------------
00511641   1/1  ----------------------------------------------------------------------
00449281   1/1  ----------------------------------------------------------------------
00482941   1/1  ----------------------------------------------------------------------
00487681   1/1  ----------------------------------------------------------------------
00478891   1/1  ----------------------------------------------------------------------
00471251   1/1  ----------------------------------------------------------------------
00397811   1/1  ----------------------------------------------------------------------
00497211   1/1  ----------------------------------------------------------------------
00384291   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PPKRAQDIISLAALDMSDWHSFAETLKLPKFAQHRNIEINIGCPNASIVDFPAELAPLFEDRNISIKMPP
00500031   1/1  eelrelrkelvrelapdiplivnlggnkltedavedyvelarrlee....gadalelnvssPntpglrel
00518991   1/1  gtvtlapqegvtdprvrrl....gaglinleglnnrglealllelakaagikglplgvniggsgpeelae
00497081   1/1  vvsdvdlstellglklknPfglapmgdknlelaralaalgaglvvtgtvtpvpqegnpkpr..lfrlped
00524811   1/1  gtvtlapmagvtdprlrrl....gagllnreglnndgleaalkllrralkagkpglpvgvnlggnrpedl
00471401   1/1  eeiralkdaagdlpvivqlgvgsdpedlaeaarraeeaGadaielnlgcPntkvlrgggaallqdpelll
00362581   1/1  eelravrlavvkraapdvpvgvnlggnkpaefgvddyelarraleaGadaivlnvsapnlpglrkdqggg
00467211   1/1  ------------------------------------ielnfssPnlpnlrsdeyggslenrprllleiik
00465991   1/1  vlgktmtpepqagnpvprarrl....deaginrlgfndlgaaaelrrllkllvksiaevpiivnlvgggi
00480291   1/1  afddvllrprvlvdvddvdlsttilglklknPlvlapmgfgglsepieaeialaraaaelgggipiilge
00399921   1/1  iipaldlkdgrvvrlivglnggdpedpveaakaaeeaGadaielndldpallgpealleviraireavgi
00411521   1/1  ---------lldlanlidltllkpdltledieklidealeygfaavcvnplyvklakdllgglkvaavvg
00491461   1/1  ----------------------------------------------------------------------
00501351   1/1  ---------------------veeaaraaeeagadalelnvdlpqlgsreldrprlllellealreavg.
00416581   1/1  ----------------------------------------------------------------------
00457121   1/1  ----------------------------------------------------------------------
00497391   1/1  ----------------------------------------------------------------------
00470261   1/1  ---------------------------------------------------------------vivkgva
00496741   1/1  ----------------------------------------------------------------------
00447601   1/1  ----eegrplvvqlagsdpedlaeaaklaee.gadgidlnfgcpvskvrrdgyGaallkdpelvleivka
00496291   1/1  ----------------------------------------------------------------------
00527141   1/1  ----------------------------------------------------------------------
00471011   1/1  ----------------------------------------------------------------------
00498481   1/1  ------------------------------------idlvincgalkagdpelvlelikavreavg...g
00492281   1/1  ----------------------------------------------------------------------
00526101   1/1  ----------------------------------------------------------------------
00495871   1/1  ---------------skdrgvlaelleraeeagadaivltvdspllgqrardlrggfllglkvtaeilal
00515981   1/1  ------------qgggidpedpaelaraaeeaGadaielndgcpfdsrlldgsgllpdpeiikavrkavs
00496751   1/1  ----------------------------------------------------------------------
00523561   1/1  --------plivalDfadleealeladal.aphvdvikvgfvlflafgpevvkalrk...ktgvpvildl
00489981   1/1  ---------------------------------------------------------------------t
00366281   1/1  ---kmkisplivalDfpdleealeladalge.gvdvikvgtplvla...fgpevvkalrkapglpvildl
00450461   1/1  --------------------------------------leagadgvhlgg.pdllleaarelglgvivgv
00514421   1/1  ----------------------------------------------------------------------
00380721   1/1  ----------------------------------------------------------------------
00502011   1/1  ----------------------------------------------------------------------
00511641   1/1  ----------------------------------------------------------------------
00449281   1/1  ------prkgliagnwkmygdpaelaeliealgaallsvltgvvlfvgpppidlaavrealdipvlaknv
00482941   1/1  ----------------------------------------------------------------------
00487681   1/1  ----------------------------------------------------------------------
00478891   1/1  ----------------------------------------------------------------------
00471251   1/1  ----------------------------------------------------------------------
00397811   1/1  -----------------------------------gidakrgkggaallddpelveaiveavkeavpvpv
00497211   1/1  --------------------------------------vvlGaldldgpldvelleellgaagglgvtfh
00384291   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TVDHNAKIREYLAVGITTFHLCNTIPTAKGGISGYPLHKYSLPAIKKARQEFGDSITIIGGGGIYTLDDA
00500031   1/1  qlglalgllpelllevveavkkavglpvivKlapdlteediaeiaraaeeagadgiivtNttggrlldle
00518991   1/1  aakllvrlleagadaielnigcpntgggaallldpelllelikalreavg.ipvivKirpgidtaedvei
00497081   1/1  ealinlyglnnegldallerlkalkallllllleaggplivqiggsglfgsrpedlaeaaelle....pl
00524811   1/1  aeaarlleeagadailelnlgcp.....ntlggsallkdpelllelleavkeavdvpvivKispgvgied
00471401   1/1  eivkavreavg.ipvivKlrpggddtvelaraaeeaGadgiivhnrtgtqlidvearkallglglgsine
00362581   1/1  allpdpelvlelikalkeavg.lpvivklapgltgvdtvelakraeeaGadavvvsnttggrgldgttrr
00467211   1/1  avreavgedvpvivKlspgldvediedlakaleeaGadaiivsngigggtgltplelagvhgglsglpla
00465991   1/1  reldaedarllleagadavelnigcpntpv..lgallakdpelvaivvaavkkavkvpvvvkivpgvddl
00480291   1/1  mgnvsle.rlaaavsgagglgsfglyalgdlevleellrrakaagikpigvnlgkpgeggalaaikvsea
00399921   1/1  pvivgggirspedaralleaGadavivgsalledpellaellealgpevivvaidvkavgvpvtvkirgg
00411521   1/1  fPlGasttedkveeakaaveagadeieinishgnl.................legdlelllelikaikea
00491461   1/1  ------------------------------GvtGqktgfipevlelvkevkkat..dipvivggGIstpe
00501351   1/1  vpvivKlvggvltvedaralleaGadaivvsgggggghidvetlravgaattggllgvgv..ptlallae
00416581   1/1  ---------------------adfiktstGfggg....gatlealrlilevvkdkipviaaGGIrtgeDa
00457121   1/1  --------------------------------------gvdlellkelaeavpkdipviasGGisspedi
00497391   1/1  ---------------------------------------adlellrevaeav..diPviadGGIgtpeda
00470261   1/1  tved...araaaeaGadaivvsg......gggggldvgvptlealpevaeavggdipviadGGIrtgedv
00496741   1/1  ------------------------------gfggqkfipasleklkelrkligelgldipivvdGGi.np
00447601   1/1  vreavp.ipvtvkirlgwdledtvelakaleeaGadaltvhg......rtrsqrytgpadleaikevke.
00496291   1/1  -------akaaeeaGadailvtsi..drdgtlsgp.....dlellkevaeavs..ipviasGGigsleda
00527141   1/1  ------------------------------gftgqkfipsslekikalrkligelgldipivvdGGi.np
00471011   1/1  ------------------------------gftgqkfipaslekikelrklig.dipiivdGGI.npeti
00498481   1/1  vpvkviletglltveeiveaaraaveaGadfiktst......gggsg....gatlevlaliveavggkip
00492281   1/1  -----------------------------pgftgqkfipgvleklkalrkligelgldipiivdGGI.np
00526101   1/1  --------------------------avaeglsglliiyleadgtpvdlelvkevkkavp.dipvivgGG
00495871   1/1  rlvppgealispahgdpilsledlkalrealg.vpvivkgvltved...allaaeaGadaivvsgh....
00515981   1/1  vpvivkgrigsdedvelalaagadgvtvgtlagedpeelleaakelglpvivgardakealraarlgrea
00496751   1/1  ------------------------------gfggqkfipsvlekikelrklig.dipiivdGGin.peti
00523561   1/1  klmdigntvadyaeaaaeagadgvtvhaeagpdtleallglkllilvtvltseealealllgadyvavla
00489981   1/1  gvdavelakrleelgadeilvtsi..drdgtlsgp.....dlellkklaeavs..ipviasGGigsledl
00366281   1/1  KladigntveaaaeaaaeaGadaitvhgyagsdtlkelleaakelglgvlvllspstegllelllelvll
00450461   1/1  svhtleealeaeelgadyill..gpvfptgtkpgf..gplglellrelveav..kipviasGGi.tpena
00514421   1/1  -----------------------------------------lellrevve...vgipviadGGIrtpeda
00380721   1/1  --------------------------------------------irrireav..dvpvivggGistpedv
00502011   1/1  ------------------------------gvtGtls...diellkalreavgipv.viagGGistpeda
00511641   1/1  ---------------------------------------pdlellkevveav..dipviaeGgIntpeda
00449281   1/1  lpnesGaftgevsvellleaGadgvilghserrlalgepdelieaakklglkvivcvgevlearralalg
00482941   1/1  ---------------------------------GfllggatledvllmleavggldvgvkaaGGirtled
00487681   1/1  -------------------------------------levdldtllellklvpedipvvaegGIstpedv
00478891   1/1  ------------------------------ggdgvvfgpaglellrelre...ldipvivdGGi.tpeda
00471251   1/1  -------------------ailltsrtvtgtlsgpd.....lellkevaeavs..ipviasGGigtpeda
00397811   1/1  tvkirggtelgdidavelakaleeaGadailvtgr..trdgtlsg.....adlelirevkeav..kiPVi
00497211   1/1  raldaaldaeealedlielGvvrilt...........sGgaagaleglellkelvela.gripivagGGi
00384291   1/1  -----------------------------gdgag..geganlelieaireavg..ipviasGgi.tpeda


                         -         -         -         +         -         -         -:280
query           KKYIEAGADHLSLSSIMFNPIRGKKLVKEIVKFWLDDF--------------------------------
00500031   1/1  pllgveagglsgaalkplalrlvaevreavgg--------------------------------------
00518991   1/1  akaleeaGladaiivsnrtggtlaadigpgsll-------------------------------------
00497081   1/1  adaielnlscPakpglggllgaalledfiaaarr------------------------------------
00524811   1/1  iediakalveaGadaivvsntthggrqldieg--------------------------------------
00471401   1/1  tgglsgpaippaaleliaevreavp.gipvianGGIr---------------------------------
00362581   1/1  vaeagglsGaplkpaslellreiaeavggd----------------------------------------
00467211   1/1  paslevlaelreavggripviadGGirsgedaak------------------------------------
00465991   1/1  veiakaleeaGadaiivt----------------------------------------------------
00480291   1/1  gadaidlnlgaplvdpvvdvgsistlggdpelvledl---------------------------------
00399921   1/1  ldltdvdavelakaleeagadailvt.......g------------------------------------
00411521   1/1  vg.gvvvkvilgtvlldeeeivelaealieaGaDgikv--------------------------------
00491461   1/1  dakealeaGAdgvvvGsaivkaidgalaieelle------------------------------------
00501351   1/1  vrealg.dipviadGGirtgedaakalalGAd--------------------------------------
00416581   1/1  lkalaaGadriGtssllallaglelgvv------------------------------------------
00457121   1/1  aelleaGadgvlvGsalmkapdplkear------------------------------------------
00497391   1/1  akalelGAdgVlvGsaiagaedPgemaralklav------------------------------------
00470261   1/1  akalalGAdgVlvGtaflyaleapgeegvkealeall---------------------------------
00496741   1/1  enikkaleaGadgvvvGsaifkaddpkeaikelrel----------------------------------
00447601   1/1  ...sipvianGgirtpedaakaleatGadgVmig------------------------------------
00496291   1/1  aellaaGadavlvGsal...lggplllkeikellee----------------------------------
00527141   1/1  etikkaieaGadgvvvGsaifkaedpkeaikelre-----------------------------------
00471011   1/1  keaieaGadgvvvGsaitkaedpaeaikalreelkegl--------------------------------
00498481   1/1  viaaGGirtaedalkala----------------------------------------------------
00492281   1/1  enikkaieaGAdgvvvGsaifgaedpkeaikelr------------------------------------
00526101   1/1  Isspedakelle.gAdgvvvGsaiyk...gpdi-------------------------------------
00495871   1/1  ..ggggldvgvptlealpevaeavggdipviadGGirt--------------------------------
00515981   1/1  lrtkgikllpdvvttveaaraaeeaGadvigvtg------------------------------------
00496751   1/1  kkaieaGadivvvGsaifkaedpeeaikalrkalkea---------------------------------
00523561   1/1  vepgldgvvvgatelellkelrealp.dipvivd------------------------------------
00489981   1/1  kellelsnlletgadgvlvgsal...lggpltle------------------------------------
00366281   1/1  vaylavelgvdgvvvgatnlellkeirellg.dv------------------------------------
00450461   1/1  aealeaGadgvavgsailgapdpaeaakalleav------------------------------------
00514421   1/1  akalaaGAdgvlvGsallgapeppgeakelle--------------------------------------
00380721   1/1  aelleaGAdgvvvGsaivkllaedpeeaikellelik---------------------------------
00502011   1/1  aelle.gAdgvvvGsaifk...gedplkeaieflkae---------------------------------
00511641   1/1  kkalalGadavmvGsailgnpeileaakelle--------------------------------------
00449281   1/1  adaiayepveaigtgkganpellpev.veavralle----------------------------------
00482941   1/1  alkllaaGadriGtssll.eilaelekg------------------------------------------
00487681   1/1  akl.aagadgvlvGsalmraddpgeavrellg--------------------------------------
00478891   1/1  aealeaGadgvvvGsaitkaedpaeaaralrealkear--------------------------------
00471251   1/1  aklleaGadgvivGsalfg...gplileeakall------------------------------------
00397811   1/1  asGGigtpedaaaaleelGadgvlvgsallggpe..----------------------------------
00497211   1/1  t.lenikelleagadgvhvgsallrasdilaaae------------------------------------
00384291   1/1  eealaagladlValGrall...anpdlvaklaeglpl---------------------------------