[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30160.1


[Show Plain Result]

## Summary of Sequence Search
   1::403
   2::208  6.3e-82 53.2% 0037940 00379401 1/1   RibB                                    
   6::211  1.5e-80 54.4% 0039907 00399071 1/1   RibB                                    
   4::206  1.7e-74 51.7% 0044038 00440381 1/1   RibB                                    
   7::204  8.4e-74 51.3% 0042499 00424991 1/1   RibB                                    
 209::376  6.5e-41 47.6% 0052081 00520811 1/1   like                                    
   1::403


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFEQIKNNVENAIEALKQGKPVVVLDDYDRENEGDLILPGQKATEENIAFMLEHTSGIICLAMDSKKARE
00379401   1/1  -llellglllssieeaiealraGklvlvvddedrenegdlvlaaelvtpelinfmirhasGliclaltee
00399071   1/1  -----llsieeaiealraGklvlvvddedrenegdlvlaAelvtpelinfmarhasGliclalteelakr
00440381   1/1  ---llllsieeaiealraGklvlvvddedrenegdlvlaaelvtpelinflvrlasGliclalteeraer
00424991   1/1  ------lsieeaiealraGklvlvvddedrenegdlviaAelvtpelinflvrhasGliclalteeraek
00520811   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LNLTPMVAADQNNSTFTTPFTVTIEAKEGVTTGVSAKDRAHTIQVASKADAKTEELARPGHIFPLIANDK
00379401   1/1  laerlgLplmve..dntsdlgtaftvsvdaaegvtTGisaadraltiraladpdakpedlvrPGHvfplr
00399071   1/1  lgLplmvdl..ndssygtaftvsidaaelgvtTGisaadRaltiraladpdakpedlvrPGHvfplrard
00440381   1/1  lgLplmve..dnsddlgtaftvsvdaalgvtTGisaadRaltirlladpnakpedlvrPGHvfplrardg
00424991   1/1  lgLplmvdlnteasellelleelleddleddlgtaftvsvdar.gvtTGisaadRaltiraladlveeee
00520811   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GVLGRNGHTEATVDLMKLSGFNSAGVLCELMNKDGTMMKAAELEAFAKKHDLPLLTIAELYQYRLATEIF
00379401   1/1  akeggvleRaGhtEaavdLarlaGlkpaavicellnddgtmarlpellefaeehglklitiedlieyr--
00399071   1/1  ggvleRaGhtEaavdLarlaglkpaaviceilnddeeaegealeedgtmarldellefaeehglklitie
00440381   1/1  gvleRaGhteaavdLarlaglkpaavicellneddgtmarldellefaeehglklitiedlieyrl----
00424991   1/1  ldalpedfvrPGHvfplrardggvleRaGhteaavdLarlagllpaavicellnddgsmarlde------
00520811   1/1  --------------------------------------------------------------------sl


                         -         -         -         +         -         -         -:280
query           VTKMASSTIPFKKIGELEMSVYKDNFSGDEVVVLSKPYSGNNPLVRMHSSCMTGDIFGSLRCDCQDQLHK
00379401   1/1  ----------------------------------------------------------------------
00399071   1/1  d---------------------------------------------------------------------
00440381   1/1  ----------------------------------------------------------------------
00424991   1/1  ----------------------------------------------------------------------
00520811   1/1  vervaeaelptl.fgefrlvayrdlidglehlalvkGdidddepvlvRvhsecltgDvlgslrcdcgwqL


                         -         *         -         -         -         -         +:350
query           GIEMISEEGGFFIYLDQEGRGIGLTNKLKAYNLQMNENMDTLEANLALGLPADARKYDLAIQVLKYNNVN
00379401   1/1  ----------------------------------------------------------------------
00399071   1/1  ----------------------------------------------------------------------
00440381   1/1  ----------------------------------------------------------------------
00424991   1/1  ----------------------------------------------------------------------
00520811   1/1  eaaleliaeegrGvlvylrqegrgigllnklrayalq.degldtveanealgfpadlrdyglgaqiLrdl


                         -         -         -         -         *         -         -:420
query           RCRLISNNPEKLAALRNVDIETQPVYCEAFVNSHNRNYLITKKIKAKHTIKGI-----------------
00379401   1/1  ----------------------------------------------------------------------
00399071   1/1  ----------------------------------------------------------------------
00440381   1/1  ----------------------------------------------------------------------
00424991   1/1  ----------------------------------------------------------------------
00520811   1/1  gvskirlltnnprklvgLegfglevv--------------------------------------------