[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30267.1


[Show Plain Result]

## Summary of Sequence Search
   1::209
   1::209  7.2e-56 40.0% 0046442 00464421 1/1   p containing nucleoside triphosphate hy 
   1::208  3.2e-40 33.3% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
   2::210  6.5e-31 26.6% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
   4::199  5.6e-30 33.5% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
   2::204  3.6e-27 28.6% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
   4::211  4.6e-27 30.7% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
   4::208  1.2e-26 31.1% 0049306 00493061 1/1   p containing nucleoside triphosphate hy 
   4::204  1.1e-25 30.5% 0051580 00515801 1/1   p containing nucleoside triphosphate hy 
   4::201  5.3e-25 35.1% 0048689 00486891 1/1   p containing nucleoside triphosphate hy 
   2::206  1.1e-24 29.1% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
   4::203  1.6e-24 32.6% 0048692 00486921 1/1   p containing nucleoside triphosphate hy 
   1::171  3.5e-24 28.4% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
   1::206  3.6e-24 30.2% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
   1::205  3.8e-24 32.4% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
   1::191    6e-23 24.9% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
   4::202  1.3e-22 32.4% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
   4::202  1.2e-21 30.2% 0046459 00464591 1/1   p containing nucleoside triphosphate hy 
   2::208  2.1e-21 31.5% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
   1::204    3e-21 33.1% 0045788 00457881 1/1   p containing nucleoside triphosphate hy 
   4::202  5.8e-21 26.1% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
   1::207  1.5e-20 32.6% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
   1::207  3.7e-20 33.3% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
   1::206  9.9e-20 27.3% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
   1::203    1e-19 25.0% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
   4::206  1.4e-19 31.5% 0051851 00518511 1/1   p containing nucleoside triphosphate hy 
   2::202  2.6e-19 28.6% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
   4::206  2.7e-19 34.1% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
   1::207  1.5e-18 25.9% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
   2::209  2.9e-18 26.9% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
   1::205  3.2e-18 25.5% 0049190 00491901 1/1   p containing nucleoside triphosphate hy 
   2::206  1.4e-16 27.1% 0049398 00493981 1/1   p containing nucleoside triphosphate hy 
   4::211  1.7e-16 29.5% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
   1::206  3.2e-16 28.1% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
   4::202  1.8e-15 26.6% 0050194 00501941 1/1   p containing nucleoside triphosphate hy 
   2::202    3e-15 22.9% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
   2::205  1.2e-14 26.1% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
   3::201  2.4e-14 28.0% 0047933 00479331 1/1   p containing nucleoside triphosphate hy 
   1::206  5.2e-14 27.8% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
   4::203  8.2e-14 28.6% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
   4::206  9.6e-14 20.6% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
   1::184  1.3e-13 22.4% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
   2::207  9.2e-13 24.1% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
   1::211  1.9e-12 22.5% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
   4::204  3.8e-12 23.8% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
   1::204  7.3e-11 24.0% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
   1::204  1.1e-10 27.3% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
   1::203  2.1e-10 22.7% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
   1::201  4.2e-10 22.4% 0045970 00459701 1/1   p containing nucleoside triphosphate hy 
   1::179  6.1e-10 22.8% 0048050 00480501 1/1   p containing nucleoside triphosphate hy 
   2::204  1.2e-09 23.0% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
   4::208  4.9e-07 22.3% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
   1::205  0.00038 21.3% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
   1::204   0.0004 21.3% 0046315 00463151 1/1   p containing nucleoside triphosphate hy 
   1::209


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLM
00464421   1/1  MkkgkfIvieGpdGsGKTTlaklLae.l.elgigvvvtrEPvdywrevggtpllelirelllaldfgeil
00487061   1/1  ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvviyepvdywaavgggdllrlirelllrlgfge
00533501   1/1  -rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigtplgrgigyvfqdpalfpgltvrenle
00469161   1/1  ---llIvieGppGsGKsTlaklLaerlgltglsvlltredgfgtplgelirelllegfqdlilvpdllvl
00464411   1/1  -vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsgeplgeligevfqdg...ilfpdltv
00532471   1/1  ---pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvgelggaalldivde..grliglvfq
00493061   1/1  ---mlIvltGppGsGKtTlakaLaerlglpvistddllreavpggtelgeyirdlfdeggl.........
00515801   1/1  ---llIvltGppGsGKtTlaklLaerl...glpfistddllreavpggtplgeeirdlldagellpdeel
00486891   1/1  ---mlivltGppGsGKtTlakaLaerl...glpvidtddllreleidgtplgeeirdlllage.......
00496571   1/1  -GkgelivllGpsGsGKsTlarlLagll...ggsvldtgepirgeplgelirglvfq..dpllldeltvl
00486921   1/1  ---mlivltGppGsGKtTlakaLaerlglpfistddllreavpggtdlgelfqelllegellfrdell..
00420081   1/1  smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvgEPiaywrsvggsdlleliyqlplrldlgei
00487021   1/1  rm..kiivltGpsGsGKsTlarlLaell...gvvvidtddllragevfqdyalfphltvlelldnvllgl
00533151   1/1  MsldikkgklivltGppGsGKtTlarlLaerl...glpfistddllrelvpggldigevfqdaleagl..
00475381   1/1  mkgeiialtGpsGsGKsTlarlLagllk....ptsgivsvdglrlavlsrdl.lgllreglirigyvfqd
00496061   1/1  ---gklivltGppGsGKtTlaklLaerl...glpvistddllreevepggtdlgeifqalllagel.lfd
00464591   1/1  ---klivltGppGsGKtTlakaLaerl...glpfistddllreavlggtplgeeirdllea.........
00457851   1/1  -PkgklivltGppGsGKtTlakaLaerlglpvistddllreavpggtrlgeviqdlfllgg.........
00457881   1/1  m.gklivltGppGsGKtTlaklLaerl...glpvidtddllrelepdgtelgellqdlllag........
00478081   1/1  ---gkvivltGppGsGKtTlarlLaellkplgggvvvi..dtddlrreairelllgldlleilf....eg
00489391   1/1  lsikkgklivltGppGsGKtTlakaLaerl...glpvistddllreavpggtdlgelfqdllle....ge
00499331   1/1  PslslkkgklivltGppGsGKtTlakaLaerlglpfidtddllrepvigagtdigevfqdlll....agg
00512061   1/1  kkkkgklivltGppGsGKtTlakaLaerl.g.glvvidtddllrea................gkirelfg
00478391   1/1  msikkgklilltGppGsGKtTlaralaerl...glpvidgddllrelvgeggrlgrd............l
00518511   1/1  ---klIvleGpsGsGKsTlaklLaekl...glpfidtddl..............................
00478131   1/1  -kgkvivltGppGsGKtTlarlLaellkplglgvvvi..dgddlrreavgqlglglsieelde....all
00515351   1/1  ---mngklivltGppGsGKtTlaraLaerl...glpvistddllreavpggtdigelfqdyllfpfltvd
00472911   1/1  mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglageggkpl................gl
00482721   1/1  -kgkiigltGpsGsGKsTlarlLae.lglpvidtddlyrelvaggtplgerirellgegyllpdea....
00491901   1/1  lmkgkiilltGppGsGKttlakaLaeelglpfidtddllreaklggelaeliedlfv.............
00493981   1/1  -kpklilltGppGsGKttlaraLaeelglpfidaddllrelvg.....................egigll
00516041   1/1  ---mlkgklillvGppGsGKtTlaralaeel...glpfvvidaddl................lrgeelgr
00493171   1/1  m.gklivllGpsGaGKsTlaklLaeklglivlsvgdttrepregevdgvdyvfvsgelfkeli.......
00501941   1/1  ---klilltGppGsGKttlaralaeel...glpfidaddllrelv.................gesirelf
00477721   1/1  -kpklilltGppGsGKttlaraLaeel...glpfidtddllrelvgegielilelfd.............
00476071   1/1  -kgkiigltGpsGsGKsTlaklLae.lglpvidtddltregvllggpllerirellgegyllfdeal...
00479331   1/1  --apkliltGppGsGKttlakaLaeel...glpfidtddllrklvgesirellelagela..........
00489631   1/1  MkgklillvGppGsGKtTlaraLaellglpf.....iridgddllrellgellgrgigfgfqqgdlleda
00498811   1/1  ---kPgkiigltGpsGsGKsTlarlLae.l...gvividgddltrelvaggglliglifqdfgl...fel
00480441   1/1  ---rlivllGpsGaGKsTlaklLaellpglivisvgdttrepregevlg..vdyvfvdrelfeelivagn
00434401   1/1  MlsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyrpaaelll
00499191   1/1  -kgkiigitGpsGsGKsTlaklLaellgatvgdvd...........gllvgvvfqddfylllpalevlen
00462761   1/1  yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr...........
00493431   1/1  ---kGelivllGpsGaGKsTllkllagllgptsgvisvggttreprpgevrg..igyvfqsgalfphliv
00461621   1/1  mkgmiialtGppGsGKsTlaklLaerl..glpfistddlyrevvergtelgklikdyfdpgalvpdllir
00451571   1/1  MsikkgeiiaivGppGsGKsTlaklLakll...glivldgddl........lreaiglvtqdgellleli
00508671   1/1  hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsgvvlld.......gddlr....
00459701   1/1  M.pkvillvGppGsGKTTlakaLakrlgekgvkvv..vidtddlrreaikqliglg..lfdedgegalrr
00480501   1/1  M.gklillvGppGsGKtTlaralaell............g.gvvvid.gddlrralvgglidgllilfle
00477561   1/1  -kkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtddlrr..alifqd.eldlfdedree..gfr
00513251   1/1  ---iellsdlslsipspevvllvGppGsGKstlakklaell...gfilidaddlr...............
00426051   1/1  kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdlggesglllrdlrrliglvfqdpilfp
00463151   1/1  M..kiIgltGpiGsGKsTvaklLaeklglpvidtgDilrkalyratglgalakiisliellilfgelvpd


                         -         -         *         -         -         -         -:140
query           IYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDP
00464421   1/1  lddtelllfalqllfatPladraehleelikpalaagklgaldlivilDRyidsdllafaaqgygrglls
00487061   1/1  pdafdnellgellealleggkivlsarraqlleirlirpllaegkvvilDrepdsadlafagagyllggl
00533501   1/1  lllvfadrygvlrglikpalaegvsvildrvglsdlaydgfprllsgggrqrvalaralvvkpdlvilld
00469161   1/1  ellaanragl.relikellaagkgvildrfplsrlayqlsggerqrlaidlegalllerllldepfpdlv
00464411   1/1  lenvalgrygll.glikealaegvivildrvglsdlaypgflsggeqqrvaiarall...pkpdlvllld
00532471   1/1  dldllpllevlellaarleellerippalsggqgqrvildrslysrpavlllllyvdeplsgldvelree
00493061   1/1  ..lllaevrelllevleealaag.gvildgfprtiesaealrallle..............lglppdlvi
00515801   1/1  r...........dlllevirellaag.gvild............gfpldleqaealrallkelglrpdlv
00486891   1/1  ....llfraevrdllyelllealeag.gvvldgf............pldleqaellrellkelglppdlv
00496571   1/1  enlalgrylhl.glilaalaagvgvvldrvglsdlay...gfprtlsglgqrqrvalarallkpdlvifl
00486921   1/1  ...........dlllevieellaag.gvildgfplslegaqalra...........llrelgldpdlvif
00420081   1/1  slddaallllslqllfaapylslnevidaarvlladefikplpagykvviiDRhplsallvFplarylgg
00487021   1/1  eirgllk........aerlervevllervgllldrippalsgGqgqrvildrallselayqpdvllldep
00533151   1/1  .........llfddefrglllerleellargpvvildgf........pggllqrealrrll.......lr
00475381   1/1  yalfprltvlenvllgllllgglvvildggvrqrlalarallldpdvllldeplllldaalrdlpdlvif
00496061   1/1  devlgll......rerldelielllagg.vvildgf............pldlegalllrealarallpdl
00464591   1/1  ..gallpdalvrdlllevikellaaggvvldgfpldleqaellrel................gprpdlvi
00457851   1/1  ..llffdeldellkerieellaag.gvild............gfpldlegaealreallragplpdlvif
00457881   1/1  ...gllpdaivrdlllelleelladgkgvildgfprdleqaeal...........rallaelglppdlvi
00478081   1/1  lllsdefrelleealalladgdvvilDgfgrlldarq.........lleelllllleepppdlvifldad
00489391   1/1  llfideiaelllealae.........aegkvvild............gtgldieqrealrelllelprpd
00499331   1/1  llvddev......rrlllealdelllaggkvvildgf........pggllqrealrrll.......prpd
00512061   1/1  flgelvfralelgllldeiekllakgkvvildgtllgteqreal......................dlvi
00478391   1/1  fdedrllfrellideidlllakgkvvildgtnlsealdealrrllr................pdlvifld
00518511   1/1  liaadlgflileifealieggflledrvvlsllayqgvildggglvledrdalrkllpkpdlviyldasp
00478131   1/1  lpdalrralleealealkagdvvildgfgrslaarq.........lllellrelgrvvkpdlvifldapp
00515351   1/1  eni.............rglllealeellaagkvvild..........glsggllqrvallral.......
00472911   1/1  lfedaleagfrqrladlirallakgkvvildgtglsreare.........ellellkelg....pvlvif
00482721   1/1  ..lfrallaellfgdll.alalldgvvydrlrdellaelsggqgdvliiegalllepgll..plpdlvif
00491901   1/1  .......prellidlikellkag.vvildgtnlgleqlral......................dlvifld
00493981   1/1  felaeraeflillideidklleegkvvildgtplllealrellreld..................lvvfl
00516041   1/1  iielfdearelvpelallfideidellakgkvvild..........gtgrlleldealellg.......p
00493171   1/1  ....dagelledaivigllyergtlldavegalldgfpvlldgalqlllllrel................
00501941   1/1  eaagrlaprellldeidellekggivildgfllt..................lrellpe...pdlvvfld
00477721   1/1  .rarfrkllielldellaaggvvldlgrtlllrralrellreldl..................vvfldap
00476071   1/1  ..drellaallfglel.egalldglvygvlqdrllerllaagpdvlildgpl..lldvell..plpdlvi
00479331   1/1  ....prillldeilellekggivldd...........ggrnllrallrell.......spdlvifldapp
00489631   1/1  tvlenlalllldeidkaledggvvlldgfdrsqlqrlai........lrallddp.....pdlvvfldap
00498811   1/1  ldrellielllenlalglalegvildalrrrllelldll.........gldvvilegplllsgglrq..r
00480441   1/1  lledaivhgllygtskerieealdaglgvlldgfprglsqaqal..................rlaldlvl
00434401   1/1  reglgidfqlpdal...........drellreevlellglgevvivdvydlsggerqr.aralasgpdvl
00499191   1/1  gaflldlllpdaldrelllelll.alveglvvlldryprllsggqrqrvaia.dpdvlildgptllldpe
00462761   1/1  ..lglliglvfqdpdllpfl....tvlenvllpllaaglivivdgt.lllvglrealrkll........g
00493431   1/1  agnllegaevhgllygtskerveealekgllvlldr...............dlsggqqlrvalar...al
00461621   1/1  lllerllfldegggflldgfprtleqaeals.........kpavlsggrkqrlalaralavdpelildgr
00451571   1/1  degilvp.deiviellrealeeldad.gvildgfp................rllgqaelllsggkadlvi
00508671   1/1  aglsiglilsded....raalrrrlgevfqelllagrlvvld............gtalglelrdelrell
00459701   1/1  reavakllldallkalkagggdvvilDgtaltleqrea............llellkelglpdlvvfldtp
00480501   1/1  deaalselvlevllealegggnpdvvildgt............nlleedrellrellkrlgrpdlvifld
00477561   1/1  vpeelvrellkellarllaeggdvvilDgtnltleqrealrrllkel............grpdlviylda
00513251   1/1  ..................gqkqrvalleaalkegylvvvDet...gldraqrlellelardlgr......
00426051   1/1  gltvglllffldnidlgllirgdeeleaalelaglprvielllegldtlaggggvvlsGgqrqrvalar.
00463151   1/1  dlvldrlvlerlvfsdpee.vildg.phplvqaeildeiaralsvvldllvldeplvglqrrlagrrgiv


                         +         -         -         -         -         *         -:210
query           ILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNAIEIDAAKSIQEVEKQIYLILDKHFNFQN-
00464421   1/1  lellrelfslllglpkpdlviyldvdpeealeRikkRg..rrfEsidleylekvreaYlelankykllq-
00487061   1/1  dleevkaleelllvlpkpdlviyldadpeelleRlkkRg..rdiEeieleylervrelyeell.epsk--
00533501   1/1  eplevldeRlrkrgrlelreldseevlekrlehylellekadrvvvidaggsleevveeilelleellk.
00469161   1/1  ifldaspeelleRllkRgreergrdldteevieerlervrdeylplaelykaadvlvid-----------
00464411   1/1  epteeldeRllkRg..rllek..leyikkrlehylelaepykddvvvidangsieevveeilkl------
00532471   1/1  lrdlleslllvlplpdlviyldadpeelleRllkRgr.dpeeqerlddleevlekylelakadterliep
00493061   1/1  fldappevlleRllkRgdseevieerlerllrllerllelykeaddlividaslsieevveeileile--
00515801   1/1  ifldaspeelleRllkrgdseevieerlerllrllerllelyeeaddvividasgsieevveei------
00486891   1/1  ifldappeelleRllkRgdseevieerlerllrllerllelykeaddvividaslsieevv---------
00496571   1/1  deppteeldeRlrkrlrlgdteevlehrleraeeladrlialyegavvvidasglsleevveeile----
00486921   1/1  ldappevlleRllkrgrpddseeeilerlerlreeyeplleeyddavvvidadgsieevveei-------
00420081   1/1  dlslealnallktleelpppdlivlldaspe---------------------------------------
00487021   1/1  lsgldaklreelrdllrellpegilpdlvifldadpeelleRllkRgreserg.epldlleevlek----
00533151   1/1  pdlvifldapleelleRllkrgrlirleddseevlekrlerylklyerliepyeeaddvividas-----
00475381   1/1  ldadpeelleRllkRg.rergeaidleylervreryeelarelaelaeadv-------------------
00496061   1/1  vifldapleelleRllkrgrllereddseevlekrlerylelyerliepykkadyvividas--------
00464591   1/1  yldasleelleRllkrgdseeriekrleelkellerlrelyrelalllpadlvvidaslsie--------
00457851   1/1  ldapleelleRllkrgreplddteevilkrlerlrelyerliepyeeaddvividaslsieevveeil--
00457881   1/1  fldaplevlleRllkrg..ddpe.ealekrlklyepllelyeeadylividaslsieevveeil------
00478081   1/1  pevlleRllkRgrrerkddseevlellekrleryepllelyeeadalviinaglsleevvee--------
00489391   1/1  lvifldadpeelleRllkrglrperegdseevlekrlerylellerliepyeeaddvividasgsie---
00499331   1/1  lvilldappeelleRllkrgrldgreddslellekrleryeeltrdlielyeeadrvividaglsie---
00512061   1/1  fldapleelleRllkrg.rdpleaielrylerlarayeeleplydadlvidnddlsleevverile----
00478391   1/1  apleelleRllkrgrhp....eseevleerleryepllepeaadlvidtslsleevveqilel-------
00518511   1/1  eelleRllkRgrplese....ellekrleayeelaplyelddlvidtsglsleevveeil....kl----
00478131   1/1  evlleRllkRgrgseddieeelleallrilepylrllaelperad.lviinadlsleevvee--------
00515351   1/1  lrpdlvifldapleelleRllkR...ddseeeilerleryreeleplleeyddalvvidadgslee----
00472911   1/1  ldadpevlleRllkr.grallreevldrllevrepy.elleead..lvidtsglsleevverilell---
00482721   1/1  ldappevlleRllkRg..gdseeeiekrleryre.iaplleaad..lvidndgsleevveqilelleel-
00491901   1/1  aplevlleRllkrg.rdlpelirlrdlerlarlleeledlyeedlvidtdglsleevverilell-----
00493981   1/1  dappeellerllkRpgrfdrrilipeeilerlleilerllaplleaadlvidtsgsleevveeile----
00516041   1/1  dlvifldappeelleRllkr...gldeeaieerlerlreilepleea.ddlvidtanldleevveeilel
00493171   1/1  ..llkpdlvilldvslevlleRllkRgrd......seevikkrleryleetplidyydlvivnddl----
00501941   1/1  aslevlleRllkRggrfderiepledleerleilealykeeadlvidtsglsleevveeile--------
00477721   1/1  leelleRllkRggrfdllielplleelkeilrellplykeladlvidtsglsleelvelile--------
00476071   1/1  fldappevlleRllkRg..gdsleeiekrleryle.laplyeead..lvidndglnllsieevve-----
00479331   1/1  evllerllrrgrldllvdeerleellkllekllplykeeadlvidtsglsleevvelilea---------
00489631   1/1  leellerllkR..dgrteeeilerlarleeryradlvivtddl..........evvekilalllel----
00498811   1/1  pdlvifldappevlleRllkRggldeetiekrlelyle.....laplygaad..ividndlsl-------
00480441   1/1  lldpslevlleRllgr...gddteevirkrlerlapeleyyeelgladvvivnddleealelllai----
00434401   1/1  ilDgptlgldvlldlpdlvifvdhdlevalerrlkrl..grsle--------------------------
00499191   1/1  lrpl.adlvifldaspeelleRllkRgrlergddleevlerilervrpdylrlieplkeradlv.id---
00462761   1/1  llsgGqkqrvadlvvlldadpevllaReptrg.ldpeteeeleellerleereplyg..adiviithdls
00493431   1/1  vvfildpslelldeRlsgrda.............dtreeirkrlkrlleelgplieydyvivnd------
00461621   1/1  llgrrllplpdlvifldaspeelleRllkrgrergllvrlddleerilkrdlrdylreieplkd------
00451571   1/1  fldaplevlleRllkrdd.ekilkr.leeqkqrvaiarallkkpailildept.sldevveeil------
00508671   1/1  keaglpllvvfldaplevlleR....drrglypeelsgglkqrvaiarplelaaepdlvidts-------
00459701   1/1  leelleRllkrlkrplpgrldrrieeiledlkgrleiyekpteplleyydkiiklidid.n---------
00480501   1/1  apleellerllkrgredlslevllkrle...plyeelil-------------------------------
00477561   1/1  pdeelleRllkrrkedrp.dlldkdleelleefegrddeyeppyepaddiieid..lsrleiye------
00513251   1/1  ...pvlviflatspevlierlldrvllldegslvdlgvledllaslepltnregldlvidlplspeev--
00426051   1/1  ..pdlllfldeptselleRllkrltrpgldadteeellellerlareyerlieplkkggatiivd-----
00463151   1/1  adgrdigtvvfpdaelvkllleasleeradrvlvvivsdgRlddleelilerllerilltieer------