[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30290.1


[Show Plain Result]

## Summary of Sequence Search
   1::1417
   3::1351       0 44.7% 0038871 00388711 1/1   and beta-prime subunits of DNA dependen 
  12::1351       0 49.9% 0039236 00392361 1/1   and beta-prime subunits of DNA dependen 
  13::1351       0 48.0% 0038898 00388981 1/1   and beta-prime subunits of DNA dependen 
   1::1417


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
00388711   1/1  --lelllsdivlkeiksikfglaspeeirklsvgevtkpetinyrtlkpergglfderlGgpdkdleCat
00392361   1/1  -----------vkeiksikfslaspeeirkwsvgevtkpetinyrtlkpekgglfDerlGgpdkdyeclc
00388981   1/1  ------------keiksikfslaspeeirkwsvgevtkpetinyrtlkpergglfderlGgplkdyeclc


                         -         -         *         -         -         -         -:140
query           GKYKRLKHRGVVCERCGVEVEQAKVRRERMGHIDLVCPVVHIWYLKSLPSRIGLFLDMPLKNVEKVLYFE
00388711   1/1  ...............Cgve...skvcpghfGhIeLalpvfhigflkellsllrliClnCgkllldlslke
00392361   1/1  gkykrvrykgivCetCgvevtdskvcrghfGhIeLalPVfhiwflkelpslLgllcllcgklllkvlyfe
00388981   1/1  gkykrvrykglvCetCgvevteskvcrghfGhIeLalpvfhiwflkellsllgllcllclkllldllyfe


                         +         -         -         -         -         *         -:210
query           SYIVTDPGMTPLEKKQLLTDEEYAEALENYGYEFEASMGAEAIRDLLADTDIESEIELLQAECEESKSTA
00388711   1/1  lekvlyfllykvllklvlkllklllllellklllll..lkkfkacigcgaiqpllkklgllllllllkee
00392361   1/1  syivldpgdtkllklllirdpklrlllvlsllklklicealelldvlekllskllkeglllledlvelll
00388981   1/1  lylvllpllrlllllellllkkvlellkklkvclncgllqplirkeglklllllkkklddiflaligaea


                         -         -         -         +         -         -         -:280
query           KKEKAIKRLRLLETFQASGNKPEWMVMTVLPVLPPDLRPLVPIEGGRFATSDLNDLYRRVINRNNRLKKL
00388711   1/1  lkelssklkkrlltplevleilkkilkedllllgfllsgarpewliltvlpVpPpdlRPsvvldggrfae
00392361   1/1  dellllleddlllllllklllllellkllllellllllselllellsllllelneelelllllllellel
00388981   1/1  ilkllsdldlellklllr.lllpllvleilkkilkrlllllgfllsgarPewliltvlpVpPpdlRPsvv


                         -         *         -         -         -         -         +:350
query           LDLNAPDIIVRNEKRMLQEAVDALLDNGRRGRAVTGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGR
00388711   1/1  ddltvllrriikrnnrlkrllelgapaiillnekrlLqeaVdalidnelrglpvalgksnrplkslsqrL
00392361   1/1  leenlnleldlllallalnllltlgellellellkealkklalelsllallknlkleelllllllikell
00388981   1/1  ldggrfaeddltlllrriikrnnrlkkllelgapaiilrnekrlLqeaVdalidnglrglpvalgksnrp


                         -         -         -         -         *         -         -:420
query           SVITVGPSLRLHECGLPKKMALELFKPFVYSKLRLGGHATTIKQAKRMVELEEAVVWDILETVINEHPVL
00388711   1/1  kgKeGrfRqnLlGKRvdfsaRsVIspdpnLkldevgvPkliAleLtfPeivtkfniellrklvlngpnvy
00392361   1/1  lknkllvlllllllleelverklllklsgkldlisklllllnlllllelllsllllllrleellrdllin
00388981   1/1  lkslsqrlkgKeGrfRqnLlGKRvdfsaRsVIspdpnLklnevgvPlliAleLtkPevvtklniekngpn


                         -         -         +         -         -         -         -:490
query           LNRAPTLHRLGIQAFEPRLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLTVESQLEARVLMMSTNNILS
00388711   1/1  pgalyvlledglatnlklakkllalqleigwivlrhlidgdvvllNRqPtLHrlsiqahrvkllegktir
00392361   1/1  llnlallklllelskkkkkcpgcgliqplirkeglkllllffkaligaeaikklldnldleeekeelr.l
00388981   1/1  iypgalliiredglleigwivlrhlidgdvvLlNRqPTLHrlsiqafrvkllegktirlnplvcspyNAD


                         *         -         -         -         -         +         -:560
query           PASGQPIITPTQDIVLGLYYITREKEGARGEGKLFSSYEDVSRAYNSGTIDIHAKIKLRIDRQVFDTKGN
00388711   1/1  lnplvcspyNADFDGDemnlhvPqsleAraEallLmlvdnnilspkngkPiigliQDillglylltlrd.
00392361   1/1  llpeevleilkkilkrlllllgfllsgarPewmiltvlpVpPpdlRPsvqldggrfaeddltyllrriik
00388981   1/1  FDGDemnlhvPqsleAraEarllmlvsnnilspkngkPiiglvQDillglylltlrdtfldreellflll


                         -         -         -         *         -         -         -:630
query           TYNEKGVVNTTVGRALLLNILPEGLSFSLLNKVLVKKEISKIINQAFRVLGGKATVVLADKLMYAGFKYS
00388711   1/1  .......tfldrdevlqllllllldlillpppailk..............pvplwtGkqllslilpknin
00392361   1/1  rnnrlkrllelgapeiilrnekrlLQeaVdaliDngrrglpvalgknnrplkslsqrLkgKeGrfRqnLl
00388981   1/1  levllalglglillpppailk.................pvplwtGkqlfslilpkninllllllllldse


                         -         +         -         -         -         -         *:700
query           TLSGVSVGVDDMTIPDNKEAKIEEAEKEIKQITEQYQSSLITENERYNNIINIWSKTSDEVGASMMDAIS
00388711   1/1  llllnklllllslndslvlilngelllgvldkktlgasskslihllyelygpeeaakfldrlkrlgfryl
00392361   1/1  GKRvdysaRsVIvpdPnLklnevgvPkeiAleLtkPevvtklniekngpnikpgalyviredglleigwi
00388981   1/1  llllslnddyvliengelllgvldkktvgalaeelellllnklldkkslgslihllyelygpeaaakfld


                         -         -         -         -         +         -         -:770
query           KDTVSINGEKKEIESFNSVYMMAKSGARGSYNQMRQLAGMRGLMAKPDGTMIETAITANFREGLSVLQYF
00388711   1/1  tlaGfSigidDlilppellekkkelieeakkevleliklyrsglltllpgltleeelenkvidilnkard
00392361   1/1  vlrhlidgdpVLlNRqPTLHrlsiqafrvkllegktirlhplvcspyNADFDGDemnvHvPqsleAraEa
00388981   1/1  klkrlgfryltlagfSigidDlilpkeklellkeaekevleliklallglltllelenkvieilnkardl


                         -         -         *         -         -         -         -:840
query           TSTHGARKGLADTALKTANAGYLTRRLVDVAQDLVVIEEDCGTDDGLMFSAIVEDGEVKVPLVERALGRT
00388711   1/1  elgklalksl..............dplNsllmMalsGakGslinisqlvgmvGqqaveggripegfsgrt
00392361   1/1  rllmlvdnnilspangkPiigliQDmllglylLTlrdtfldreellflsylevllalglglidlpapail
00388981   1/1  lgklilknllkd...........dplNslliMvlsGakGsllnisqlagmlGqqaveggriirgfvlnsf


                         +         -         -         -         -         *         -:910
query           LAADVVTEKGVVLLEAGTLLDENLVELLDDNGIDMIKVRSPITCKTRRGLCAKCYGRDLARERQVNVGES
00388711   1/1  LPhflkddlspesrGfvlnsfleGLtplEyffhamggReGliDTAvkTAesGYLqRrLvkvledvvvryd
00392361   1/1  kpkplwtgkqlfslilpnlinlivillnlelkekvylkilgllilttlgrilflslldsavlirngelll
00388981   1/1  leGLtplEyffhamggReGliDTAvkTAesGYLtRrLvkvledvvvryddtvrdggivqflygedgldpl


                         -         -         -         +         -         -         -:980
query           VGVIAAQSIGEPGTQLTMRTFHTGGAASLGITVSDIKVKTAGKIKFKNIRTVTNKEGQEIVISRAGEIIV
00388711   1/1  gtvrnsgglviqflyGedgldptkveflnlpllllsnllfllkfkldllnesllrkvlllslverllgrv
00392361   1/1  gvldkklvgaslgslihllfelygpeeaakfldklkrlgfryltlaGfSigidDlilpeeklelvkeaik
00388981   1/1  kletlilpllllllgrvlakdilll.gellaklntliledllslllnagallllevlirsvltceslagv


                         -         *         -         -         -         -         +:1050
query           SDTMGRVREQHKIPMGAVVPLASGKAVEIGDVIATWDPHAQPLITDVAGKVVLEDVIDGITSKHTYDDLT
00388711   1/1  laldildpetgelladrntlidifllgdlkvvlpvnlkrlillalliflinlgsvsdllplkvielveel
00392361   1/1  kakkieleylpgllteeelenkvidilnkardlvgkialksllkd...........dplNslliMalsGa
00388981   1/1  cllcygrdlylgslvepGeaVGiiAAqSiGEPgTQlTLrTFHtaGvas......................


                         -         -         -         -         *         -         -:1120
query           GQQTIEITSISQRTTSKNLKPVVKIVDEKGAKLKSIPLAVGAVLNVADDSILEVGDIVAKIPLEGSKNKD
00388711   1/1  lkkllivlgedllslealinatllfkvllrsvltckrvlserglcslcygwllaeielkylgalvepGea
00392361   1/1  kGsiinisqlagmlGqqaveggriprgfvknsFleGLtplEyffhamggReGliDTAvkTAesGYLqRrL
00388981   1/1  ......................................................................


                         -         -         +         -         -         -         -:1190
query           ITGGLPRVAELFEARRPKDAAILSPCDGMVRLGNRDTKEKQRIEIIDKNGHIVEEILLPKSRHLVVFDGE
00388711   1/1  VGiiAAQSiGEPgTQmTLrTFHtaGvasanvtl........gvprlkeilnaskn.....iktpiltlyl
00392361   1/1  vkvledvvvryddtvrd.giivqflygedgldptkleslllplllrllgrvlakdvld..gellakkntl
00388981   1/1  ......................................................................


                         *         -         -         -         -         +         -:1260
query           QVSRGDVLADGPTDPHDLLKYKGLEEFADYILIEAQSVYRMQGVVINDKHIETIVRQMLRKAVILDEGDS
00388711   1/1  ldelsldlekakivkgslelvtlgdvvesieilaepdpltlvilldl.elvkllllvldllvvellills
00392361   1/1  ideklllllikalnatlileilirsvltcsskagvcllcygrdlytgslvepGeaVGiiAAQSiGEPgTQ
00388981   1/1  .................akditlGlprlkellearkkiktpiitlvlgvvlklelakllkvlieltlls.


                         -         -         -         *         -         -         -:1330
query           KFVKDESIELVRILEENDKLRKQGKKEVEYELVLMGITRSSLSTESFLSAASFQETTRVLTEASINSQID
00388711   1/1  gllllleldvl......................klyllsldallvvndgdlvlggdvlvllvlenaktld
00392361   1/1  lTLrTFHtaGvagaa.......................................................
00388981   1/1  ...eiylvpvllsllvklgilvdlvdllrtgsndileilevlGieaarnylvneiqkvyrlqgvdiddrh


                         -         +         -         -         -         -         *:1400
query           NLRGLKENVLIGRLIPTGTGLAVRKESAKIEKMREELGVEDNMVFTDLSSFNPEEISFDSIQSQKEDKDI
00388711   1/1  itqglprveellearlpkdll-------------------------------------------------
00392361   1/1  .....................-------------------------------------------------
00388981   1/1  leliadqmtskvlildsgdtd-------------------------------------------------


                         -         -         -         -         +         -         -:1470
query           NEDIEESLRNALESLDF-----------------------------------------------------
00388711   1/1  ----------------------------------------------------------------------
00392361   1/1  ----------------------------------------------------------------------
00388981   1/1  ----------------------------------------------------------------------