[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30340.1


[Show Plain Result]

## Summary of Sequence Search
   1::274
   4::261    1e-50 27.7% 0047681 00476811 1/1   )-binding Rossmann-fold domains         
   1::193  1.7e-50 34.6% 0051568 00515681 1/1   )-binding Rossmann-fold domains         
   2::215  1.8e-47 31.6% 0050365 00503651 1/1   )-binding Rossmann-fold domains         
   4::215  2.9e-47 30.6% 0050967 00509671 1/1   )-binding Rossmann-fold domains         
   1::274  5.1e-47 29.6% 0038342 00383421 1/1   )-binding Rossmann-fold domains         
   1::215  3.9e-46 31.3% 0045076 00450761 1/1   )-binding Rossmann-fold domains         
   3::223  6.4e-46 34.3% 0053286 00532861 1/1   )-binding Rossmann-fold domains         
   4::214  7.6e-46 34.6% 0051355 00513551 1/1   )-binding Rossmann-fold domains         
   4::274  1.5e-45 31.1% 0051542 00515421 1/1   )-binding Rossmann-fold domains         
   1::264  2.4e-45 30.1% 0035471 00354711 1/1   )-binding Rossmann-fold domains         
   1::215  3.8e-45 31.1% 0051006 00510061 1/1   )-binding Rossmann-fold domains         
   1::259  4.2e-45 27.2% 0051203 00512031 1/1   )-binding Rossmann-fold domains         
   6::274  7.6e-45 31.1% 0051093 00510931 1/1   )-binding Rossmann-fold domains         
   1::255  7.9e-45 30.0% 0043703 00437031 1/1   )-binding Rossmann-fold domains         
   1::191    1e-44 34.0% 0037662 00376621 1/1   )-binding Rossmann-fold domains         
   1::190  1.4e-44 35.3% 0050776 00507761 1/1   )-binding Rossmann-fold domains         
   5::222  2.4e-44 35.4% 0046483 00464831 1/1   )-binding Rossmann-fold domains         
   1::257  2.7e-44 30.0% 0035018 00350181 1/1   )-binding Rossmann-fold domains         
   1::265  3.4e-44 30.9% 0051260 00512601 1/1   )-binding Rossmann-fold domains         
   4::247  3.5e-44 30.9% 0042131 00421311 1/1   )-binding Rossmann-fold domains         
   1::257  4.3e-44 30.5% 0050955 00509551 1/1   )-binding Rossmann-fold domains         
   1::247    5e-44 29.5% 0047124 00471241 1/1   )-binding Rossmann-fold domains         
   1::253  5.4e-44 35.9% 0051109 00511091 1/1   )-binding Rossmann-fold domains         
   1::223  5.6e-44 32.5% 0051763 00517631 1/1   )-binding Rossmann-fold domains         
   3::255  1.1e-43 29.8% 0051511 00515111 1/1   )-binding Rossmann-fold domains         
   1::247  1.2e-43 32.4% 0042429 00424291 1/1   )-binding Rossmann-fold domains         
   4::223  1.8e-43 32.3% 0053266 00532661 1/1   )-binding Rossmann-fold domains         
   1::192  2.1e-43 37.2% 0036194 00361941 1/1   )-binding Rossmann-fold domains         
   3::223  2.6e-43 32.5% 0049943 00499431 1/1   )-binding Rossmann-fold domains         
   6::264  2.6e-43 32.6% 0050655 00506551 1/1   )-binding Rossmann-fold domains         
   4::223  2.8e-43 33.5% 0052368 00523681 1/1   )-binding Rossmann-fold domains         
   1::247  3.8e-43 30.9% 0045153 00451531 1/1   )-binding Rossmann-fold domains         
   2::221  4.3e-43 33.7% 0036806 00368061 1/1   )-binding Rossmann-fold domains         
   1::191  4.7e-43 34.4% 0038042 00380421 1/1   )-binding Rossmann-fold domains         
   1::223  4.7e-43 33.0% 0050237 00502371 1/1   )-binding Rossmann-fold domains         
   3::238  4.7e-43 31.5% 0052529 00525291 1/1   )-binding Rossmann-fold domains         
   1::216  5.1e-43 31.1% 0039438 00394381 1/1   )-binding Rossmann-fold domains         
   5::193  5.3e-43 35.9% 0038068 00380681 1/1   )-binding Rossmann-fold domains         
   5::255  8.3e-43 31.6% 0036922 00369221 1/1   )-binding Rossmann-fold domains         
   1::223  9.2e-43 34.3% 0051440 00514401 1/1   )-binding Rossmann-fold domains         
   1::190  1.9e-42 36.4% 0038770 00387701 1/1   )-binding Rossmann-fold domains         
   1::198    2e-42 33.7% 0051965 00519651 1/1   )-binding Rossmann-fold domains         
   4::223  3.2e-42 31.3% 0049902 00499021 1/1   )-binding Rossmann-fold domains         
   1::197  3.6e-42 34.4% 0041366 00413661 1/1   )-binding Rossmann-fold domains         
   4::223  3.9e-42 33.3% 0052085 00520851 1/1   )-binding Rossmann-fold domains         
   4::255  4.5e-42 30.2% 0051279 00512791 1/1   )-binding Rossmann-fold domains         
   1::255  6.9e-42 30.5% 0043678 00436781 1/1   )-binding Rossmann-fold domains         
   1::275  7.1e-42 30.9% 0048286 00482861 1/1   )-binding Rossmann-fold domains         
   1::268  7.9e-42 28.8% 0035305 00353051 1/1   )-binding Rossmann-fold domains         
   1::193    9e-42 34.6% 0039871 00398711 1/1   )-binding Rossmann-fold domains         
   1::202  9.8e-42 32.0% 0038814 00388141 1/1   )-binding Rossmann-fold domains         
   5::260  1.1e-41 30.0% 0051955 00519551 1/1   )-binding Rossmann-fold domains         
   6::223  1.2e-41 33.2% 0048949 00489491 1/1   )-binding Rossmann-fold domains         
   1::190  1.3e-41 34.6% 0038545 00385451 1/1   )-binding Rossmann-fold domains         
   4::201  1.9e-41 32.7% 0047470 00474701 1/1   )-binding Rossmann-fold domains         
   1::190  2.7e-41 35.3% 0049942 00499421 1/1   )-binding Rossmann-fold domains         
   5::255  4.4e-41 30.2% 0049845 00498451 1/1   )-binding Rossmann-fold domains         
   5::216  6.9e-41 35.2% 0046801 00468011 1/1   )-binding Rossmann-fold domains         
   1::191  8.7e-41 34.9% 0041610 00416101 1/1   )-binding Rossmann-fold domains         
   6::223  9.4e-41 34.7% 0050383 00503831 1/1   )-binding Rossmann-fold domains         
   1::257  1.1e-40 29.0% 0041757 00417571 1/1   )-binding Rossmann-fold domains         
   6::223  1.2e-40 31.4% 0042505 00425051 1/1   )-binding Rossmann-fold domains         
   1::190  1.3e-40 34.6% 0051702 00517021 1/1   )-binding Rossmann-fold domains         
   5::246  3.1e-40 30.6% 0048243 00482431 1/1   )-binding Rossmann-fold domains         
   4::190  3.5e-40 33.9% 0040910 00409101 1/1   )-binding Rossmann-fold domains         
   1::190  8.6e-40 34.4% 0050022 00500221 1/1   )-binding Rossmann-fold domains         
   4::255  2.3e-39 30.1% 0052873 00528731 1/1   )-binding Rossmann-fold domains         
   1::217  2.9e-39 31.8% 0052988 00529881 1/1   )-binding Rossmann-fold domains         
   1::223  3.8e-39 32.7% 0046592 00465921 1/1   )-binding Rossmann-fold domains         
   2::191  8.5e-39 34.1% 0041692 00416921 1/1   )-binding Rossmann-fold domains         
   4::267    1e-38 27.6% 0048614 00486141 1/1   )-binding Rossmann-fold domains         
   5::223  1.4e-37 32.2% 0048361 00483611 1/1   )-binding Rossmann-fold domains         
   6::183  1.4e-37 37.3% 0048035 00480351 1/1   )-binding Rossmann-fold domains         
   4::189  5.3e-36 35.2% 0038559 00385591 1/1   )-binding Rossmann-fold domains         
   4::264  8.4e-36 31.5% 0052744 00527441 1/1   )-binding Rossmann-fold domains         
   6::245  3.1e-35 29.5% 0049026 00490261 1/1   )-binding Rossmann-fold domains         
   6::188  5.9e-34 34.5% 0049519 00495191 1/1   )-binding Rossmann-fold domains         
   6::196  1.4e-33 34.5% 0046034 00460341 1/1   )-binding Rossmann-fold domains         
   6::251  1.9e-33 30.0% 0048293 00482931 1/1   )-binding Rossmann-fold domains         
   6::195  3.1e-33 34.7% 0046897 00468971 1/1   )-binding Rossmann-fold domains         
   5::198  7.9e-32 31.5% 0051491 00514911 1/1   )-binding Rossmann-fold domains         
   6::196    1e-31 34.3% 0050721 00507211 1/1   )-binding Rossmann-fold domains         
   1::250  2.2e-31 27.7% 0051183 00511831 1/1   )-binding Rossmann-fold domains         
   1::183  3.3e-31 35.6% 0046574 00465741 1/1   )-binding Rossmann-fold domains         
   4::222  6.9e-31 32.4% 0049428 00494281 1/1   )-binding Rossmann-fold domains         
   4::195  5.1e-30 32.7% 0049357 00493571 1/1   )-binding Rossmann-fold domains         
   6::195  7.4e-30 28.9% 0049864 00498641 1/1   )-binding Rossmann-fold domains         
   4::196  9.5e-30 30.3% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
   5::188  2.2e-28 29.6% 0046291 00462911 1/1   )-binding Rossmann-fold domains         
   6::196  2.6e-28 34.7% 0049117 00491171 1/1   )-binding Rossmann-fold domains         
   4::257  6.6e-28 27.1% 0053287 00532871 1/1   )-binding Rossmann-fold domains         
   4::169  8.2e-28 31.6% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
   6::198  1.1e-27 31.4% 0043337 00433371 1/1   )-binding Rossmann-fold domains         
   6::176  1.1e-27 38.9% 0048516 00485161 1/1   )-binding Rossmann-fold domains         
   1::199  1.3e-26 31.7% 0046472 00464721 1/1   )-binding Rossmann-fold domains         
   6::153  2.8e-26 35.8% 0046529 00465291 1/1   )-binding Rossmann-fold domains         
   1::153    1e-25 30.7% 0047965 00479651 1/1   )-binding Rossmann-fold domains         
   6::185  2.1e-24 30.2% 0051925 00519251 1/1   )-binding Rossmann-fold domains         
   3::159  9.4e-24 33.6% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
   1::250  1.8e-23 25.1% 0052722 00527221 1/1   )-binding Rossmann-fold domains         
   7::198  1.9e-23 25.4% 0037128 00371281 1/1   )-binding Rossmann-fold domains         
   1::266  6.4e-23 26.3% 0043041 00430411 1/1   )-binding Rossmann-fold domains         
   1::183  1.3e-22 29.4% 0038324 00383241 1/1   )-binding Rossmann-fold domains         
   6::159    4e-22 36.2% 0038784 00387841 1/1   )-binding Rossmann-fold domains         
   1::189  1.2e-21 31.9% 0051991 00519911 1/1   )-binding Rossmann-fold domains         
   1::183  1.3e-21 28.3% 0040043 00400431 1/1   )-binding Rossmann-fold domains         
   6::183  4.4e-21 26.9% 0041999 00419991 1/1   )-binding Rossmann-fold domains         
   1::197  9.7e-21 28.1% 0043042 00430421 1/1   )-binding Rossmann-fold domains         
   6::159  1.6e-19 36.2% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
   6::167  2.8e-19 28.9% 0048414 00484141 1/1   )-binding Rossmann-fold domains         
   2::158  3.7e-19 34.1% 0035477 00354771 1/1   )-binding Rossmann-fold domains         
   1::183  1.4e-18 28.4% 0052116 00521161 1/1   )-binding Rossmann-fold domains         
   6::132  6.1e-16 31.0% 0040551 00405511 1/1   )-binding Rossmann-fold domains         
   5::167  6.8e-15 27.2% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
   6::148  1.1e-14 28.2% 0034872 00348721 1/1   )-binding Rossmann-fold domains         
   5::135  6.2e-14 29.8% 0042906 00429061 1/1   )-binding Rossmann-fold domains         
   6::111    7e-14 31.7% 0035290 00352901 1/1   )-binding Rossmann-fold domains         
   6::158  2.8e-13 30.9% 0051996 00519961 1/1   )-binding Rossmann-fold domains         
   6::199  4.1e-13 28.8% 0047178 00471781 1/1   )-binding Rossmann-fold domains         
   4::136  7.1e-12 30.3% 0048455 00484551 1/1   )-binding Rossmann-fold domains         
   4::187  7.6e-12 29.0% 0051696 00516961 1/1   )-binding Rossmann-fold domains         
   6::102    2e-11 31.0% 0042340 00423401 1/1   )-binding Rossmann-fold domains         
   6::89   2.4e-11 34.6% 0036746 00367461 1/1   )-binding Rossmann-fold domains         
   4::169  1.7e-10 22.7% 0048469 00484691 1/1   )-binding Rossmann-fold domains         
   6::160  4.7e-10 29.3% 0049198 00491981 1/1   )-binding Rossmann-fold domains         
   1::157  8.4e-09 23.2% 0036007 00360071 1/1   )-binding Rossmann-fold domains         
   6::140  2.1e-08 31.2% 0037437 00374371 1/1   )-binding Rossmann-fold domains         
   6::140  9.3e-08 20.2% 0048227 00482271 1/1   )-binding Rossmann-fold domains         
   6::126  1.2e-07 29.8% 0047032 00470321 1/1   )-binding Rossmann-fold domains         
   6::88   1.7e-07 28.9% 0051327 00513271 1/1   )-binding Rossmann-fold domains         
   5::103  2.6e-07 29.7% 0043276 00432761 1/1   )-binding Rossmann-fold domains         
   5::91   7.5e-07 25.9% 0038711 00387111 1/1   )-binding Rossmann-fold domains         
   6::88   7.7e-07 27.8% 0050203 00502031 1/1   )-binding Rossmann-fold domains         
   1::87   2.1e-06 20.0% 0047276 00472761 1/1   )-binding Rossmann-fold domains         
   6::89   2.1e-06 23.7% 0038379 00383791 1/1   )-binding Rossmann-fold domains         
   2::91   3.4e-06 26.5% 0046725 00467251 1/1   )-binding Rossmann-fold domains         
   2::91     5e-06 27.7% 0047655 00476551 1/1   )-binding Rossmann-fold domains         
   2::88   5.4e-06 26.8% 0048107 00481071 1/1   )-binding Rossmann-fold domains         
   5::91     7e-06 30.3% 0044526 00445261 1/1   )-binding Rossmann-fold domains         
   6::67   8.6e-06 33.3% 0050910 00509101 1/1   )-binding Rossmann-fold domains         
   5::162  8.7e-06 22.7% 0042366 00423661 1/1   )-binding Rossmann-fold domains         
   2::91   1.5e-05 27.1% 0046114 00461141 1/1   )-binding Rossmann-fold domains         
   4::161  1.5e-05 31.0% 0053019 00530191 1/1   )-binding Rossmann-fold domains         
   2::91   1.9e-05 25.9% 0048673 00486731 1/1   )-binding Rossmann-fold domains         
   2::87   2.5e-05 28.8% 0050204 00502041 1/1   )-binding Rossmann-fold domains         
   6::54   3.5e-05 34.0% 0050269 00502691 1/1   )-binding Rossmann-fold domains         
   2::87   3.7e-05 30.0% 0051264 00512641 1/1   )-binding Rossmann-fold domains         
   6::91   3.9e-05 26.2% 0046253 00462531 1/1   )-binding Rossmann-fold domains         
   6::67     4e-05 23.3% 0052837 00528371 1/1   )-binding Rossmann-fold domains         
   2::171  4.4e-05 23.1% 0048799 00487991 1/1   )-binding Rossmann-fold domains         
   6::168  6.7e-05 24.6% 0047481 00474811 1/1   )-binding Rossmann-fold domains         
   2::91   0.00011 32.1% 0050890 00508901 1/1   )-binding Rossmann-fold domains         
   6::54   0.00011 34.0% 0051797 00517971 1/1   )-binding Rossmann-fold domains         
   2::89   0.00014 30.8% 0048863 00488631 1/1   )-binding Rossmann-fold domains         
   5::87   0.00014 19.7% 0044559 00445591 1/1   )-binding Rossmann-fold domains         
   6::87   0.00016 20.0% 0047992 00479921 1/1   )-binding Rossmann-fold domains         
   4::91    0.0002 28.9% 0036744 00367441 1/1   )-binding Rossmann-fold domains         
   5::55   0.00025 34.7% 0035535 00355351 1/1   )-binding Rossmann-fold domains         
   6::220  0.00044 22.6% 0038567 00385671 1/1   )-binding Rossmann-fold domains         
   3::67   0.00048 28.6% 0047346 00473461 1/1   )-binding Rossmann-fold domains         
   5::67   0.00051 27.1% 0048755 00487551 1/1   )-binding Rossmann-fold domains         
   1::157  0.00083 21.8% 0045645 00456451 1/1   )-binding Rossmann-fold domains         
   1::274


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVNNSKTILITGCSHGGIGYATAVHLKNLGHRVFASARQQKDVEALSQEGFETYLIDVTNYEYIDNALAD
00476811   1/1  ---kgkvalvTGas.sGiGlaiAralaaaGarlllVvltdrneekleelaaelrallpsggrvlavalDv
00515681   1/1  mdlkgkvalvTGas.sgiGlaiAralaaaGarVvltdrneekleelaaelealggrvlavalDvtdeesv
00503651   1/1  -slkgkvalvtGas.sgiGlaiAralaeeGakVvltdrneekleelaaelealggkvlavalDvtdeesv
00509671   1/1  ---dlkgkvalvTGas.sgiGlaiAralaaeGarVvltdrneekleelaaelealglpsgrvlavalDvt
00383421   1/1  pslslkgkvalvTGas.gGiGralaralaarGarVvlldrsglssllllsaekleelaaelggrvlaval
00450761   1/1  llvlllllllllslkgkvalvTGas.sgiGraiaralaaaGarVvlldrsseekleelaaelealggrvl
00532861   1/1  --sdmldlkgkvalvtGas.sgiGlaiAralaeeGakVvltdrneekleelaaelealggkvlavalDvt
00513551   1/1  ---lkgkvalvTGas.ggiGlaiaralaeeGdlakVvlldrneekleelaaelggrvlfvqlDvtdeesv
00515421   1/1  ---mmldlkgkvalvTGas.sGiGraiAralaarGarVvladrseelaeleagleklealaeelggrvla
00354711   1/1  MslkgkvvlvTGas.ggiGralaralaaaGarVvlldrseekleelaaelggrvlavalDvtdeesveaa
00510061   1/1  mslkgkvalvTGas.sgiGlaiAralaaeGarVvltdrneekleelaaelealglpsgrvlavalDvtde
00512031   1/1  dslsllslkgkvalvTGas.sGiGraiAralaeeGarVvltdrneekleelaaelealgggkvlavalDv
00510931   1/1  -----llllmlldlkgkvalvTGas.sGiGraiAralaaaGarVvltarneekleelaaelralggdrvl
00437031   1/1  mdlkgkvalvtGas.sGiGraiAralaaeGarVvltdrneekleelaaelrallplggrvlavalDvtde
00376621   1/1  llllmllslkgkvalvTGas.sgiGraiAralaaaGarVvltdrneekleelaaelealggrvlavalDv
00507761   1/1  m.lkgkvalvTGas.sgiGlaiAralaaeGarVvltdlrneekleelaaellealggrvlavalDvtdee
00464831   1/1  ----sgkvalvTGas.sGiGlaiAralaaeGakVvlltdrneekleelaeeleallggkvlavalDvtdl
00350181   1/1  mmdlkgkvalvTGas.sgiGlaiaralaaaGarVvlldrneekleelaaelralggrvlavalDvtdees
00512601   1/1  sdmslkgkvalvTGas.ggiGlalAralaarGarVvlldrseekleelaaelealggrvlvvalDvtdee
00421311   1/1  ---kgkvalvTGas.sgiGraiAralaaeGarVvltdrnseekleelaaeleallggralavalDvtdea
00509551   1/1  lllmlldlkgkvalvTGas.sgiGlaiAralaaaGarVvlldrneekleelaaeleallpggrvlavalD
00471241   1/1  llmllslkgkvalvTGas.sGiGlaiAralaaaGarVvltdrseekleelaaeleallggrvlavalDvt
00511091   1/1  sslsllldmlslkgkvalvTGas.ggiGralaralaarGarVvlldrseekleelaaelealgggrvlvv
00517631   1/1  mldlkgkvalvtGas.sgiGlaiaralaaaGarVvlldrneekleelaaegrvlavalDvtdeesvealv
00515111   1/1  --LkgkvalvTGAs.sGiGraiAralaalleegarVvlvarneekleelaaeleallpggrvlavalDvt
00424291   1/1  mmlslkgkvvlvtGas.ggiGralaralaaaGarVvlldrseekleelaaelgrvlavvlDvtdeesvea
00532661   1/1  ---gslkgkvalvtGAaGssgiGlaiAralaeeGakVvltdrneekleela.ellalggkvlavalDvtd
00361941   1/1  mdlkgkvalvtGas.ggiGraiaralaaaGarVvlldrneekleelaaelgrvlavvlDvtdeesveaav
00499431   1/1  --lmlldlkgkvalvtGAagssgiGlaiAralaeeGakVvltdrneekleelaeeleelgkvlavalDvt
00506551   1/1  -----sGmkvalvTGas.sgiGlaiaralaealGakVvltdrneekleelaaelealggrvlfvalDvtd
00523681   1/1  ---dllkgkvalvtGas.sgiGlaiaralaeeGakVvltdrnee.leelaeelkvlavalDvtdeesvea
00451531   1/1  psllslkgkvalvTGas.sgiGlaiAralaaaGarVvltdrneekleelaaelealggrvlavalDvtde
00368061   1/1  -dlkgkvalvTGas.sgiGlaiAralaaaGarVvlldrneekleelaaelggrvlavalDvtdeesveal
00380421   1/1  mmlslkgkvalvTGas.sGiGlaiaralaaaGarVvlldrneekleelaaeleallggrvlavalDvtde
00502371   1/1  mdlkgkvalvtGas.sgiGlaiAralaaaGarVvltdrnaekleelaaellealggrvlavalDvtdees
00525291   1/1  --gdlsgkvalvtGas.sgiGlaiAralaaeGarVvltdrneleelaaelealggrvlavalDvtdeesv
00394381   1/1  mmslkgkvalvTGas.sgiGraiaralaaaGarVvltdrsgeekleelaaelealggrvlavalDvtdee
00380681   1/1  ----gkvalvTGas.ggiGlaiaralaaeGarVvlldrneekleelaaelealggrvlavalDvtdeesv
00369221   1/1  ----gkvalvTGas.sgiGlaiAralaaaGarVvlldrsgaekleelaaelealggrvlavalDvtdees
00514401   1/1  gsslldmldlkgkvalvTGas.ggiGraiAralaaaGarVvlldrneekleelaaeleaelplllggrvl
00387701   1/1  mmdlkgkvalvTGas.ggiGlaiaralaaeGarVvlldrneekleelaaelggrvlavalDvtdeesvea
00519651   1/1  smdlkgkvalvTGas.sgiGlaiAralaaaGarVvltdrneekleelaaeleaggrvlavqlDvtdeesv
00499021   1/1  ---kgkvalvtGasnesgIGraiAlalaeeGakVvltdrneealeelaaelealldeslllslelllele
00413661   1/1  mmdlkgkvalvtGas.sgiGlaiaralaaeGarVvlldrneekleelaaelggrvlavalDvtdeesvea
00520851   1/1  ---llsllsllkgkvalvtGas.sgiGlaiAralaaaGarVvltdrsaekleelaaelealggrvlaval
00512791   1/1  ---lldlkgkvalvTGas.sgiGlaiAralaaaGarVvlldrneekleelaaelgrvlavalDvtdeesv
00436781   1/1  mdlkgkvalvTGas.sgiGlaiAralaaaGarVvlldrseekleelaaelggrvlavalDvtdeesveal
00482861   1/1  m.lkgkvvlvTGassG.iGlalaralaarGasrVvlldrneekleelaaelealggrvlfvqlDvtdees
00353051   1/1  mdlkgkvalvTGas.sGIGlaiAralaarGarvvlldrneekleelaaelralpggrvlavalDvtdele
00398711   1/1  mdlkgkvalvTGas.sgiGraiaralaaaGarVvlldrneekleelaaelggrvlavalDvtdeesveal
00388141   1/1  ldlkgkvalvTGas.sgiGraiaralaarGarVvlldrseekleelaaelggrvlavalDvtdeesvaal
00519551   1/1  ----kkvalvtGas.sgiGlaiAralaeeGarlllleeeVvltdrneekleelaaelealggkvlavalD
00489491   1/1  -----gllkgkvalvtGAagssgiGlaiAralaeeGakVvltdrn.ekleelaeeleaaggkvlavalDv
00385451   1/1  ldlkgkvalvTGas.ggiGlaiAralaaaGarVvlldrseekleelaaelggrvlavalDvtdeesveal
00474701   1/1  ---dlkgkvalvtGas.sgiGlaiAralaaeGarVvltdrneekleelaaelealggkarvlavalDvtd
00499421   1/1  ldlkgkvalvtGas.sgiGlaiaralaaaGarVvlldrseekleelaaelrvlavalDvtdeesvealva
00498451   1/1  ----gkvalvTGas.sgiGralaralaarGarVvlldrsee......ggrvlavaaDvtdeesvealvaa
00468011   1/1  ----gkvalvTGas.sgiGraiaralaaaGarVvlldrneek...........vqlDvtdeesvealvea
00416101   1/1  mmslkgkvalvTGas.sgiGlaiAralaaeGarVvltdrneekleelaaeleaggrvlavalDvtdeesv
00503831   1/1  -----lllllllllllllldlllslldlkgkvalvTGas.gGiGraiAralaaaGarVvlldrneeklee
00417571   1/1  mmdlkgkvalvTGAs.sGiGraiAralaalleeGarvvltarneekleelaaeleallpggrvlavalDv
00425051   1/1  -----kvalvTGas.sgiGraiAlalaaeGarVvltdrneealeelaggkalavalDvtdeesvealvea
00517021   1/1  ldlkgkvalvtGas.sgiGlaiAralaaaGarVvlldrseekleelaaelggrvlavalDvtdeesveal
00482431   1/1  ----lpvalvTGas.sGiGlaiAralaaaGarVvltdrlneekleelaaelralpggrvlavalDvtdee
00409101   1/1  ---mmdlkgkvalvTGas.sgIGlaiaralaaeGarvvlldrneekleelaaelealpggrvlavalDvt
00500221   1/1  lllslkgkvalvTGas.sgiGlaiAralaaeGarVvlldrseeale.....rvlavalDvtdeesvaalv
00528731   1/1  ---lkgkvalvTGas.sgiGlaiaralaaeGarVvlldrneekleelaaeleallpggrvlavalDvtde
00529881   1/1  llslkgkvalvtGasselgiGlaiAralaaeGarVvltdrneealeelaaeleggralavalDvtdeesv
00465921   1/1  mlldlkgkvalvtGaanssgiGraiAralaaeGarVvltdrneealeelaaeleaalpssllleleelle
00416921   1/1  -dlkgkvalvtGas.sgiGraiaralaaeGarVvltarneekle...ggralavvlDvtde.......ve
00486141   1/1  ---kgkvvlvtGgs.ggiGsalaralaaeGakvvlvdrseealae..gggalavaaDvtdeeavealvea
00483611   1/1  ----GkvalvtGasnesgiGraiAlalaeeGakVvitdrneealeelaaeleallseellleleellele
00480351   1/1  -----gllldtallvllllllllldlkgkvalVtGas.ggiGlaiAralaaaGarVvladrneekleala
00385591   1/1  ---egkvvLVtGgs.ggiGraiaralaaaGarVvvvdrseeal....gggvlavaaDvtdeeavaalvaa
00527441   1/1  ---amdlgllsgkvvlvTGas.ggiGralaralaarGarvVvlldrsglleekleelaaelealggrvlf
00490261   1/1  -----ktvlvTGat.GgiGsalaraLlarGaeVvaldrspeklealaaeleallpllllfellglldell
00495191   1/1  -----rktvlvTGat.GgiGsalaraLlarGaeVvlldrlssglspekleellaellealgggvefvqgD
00460341   1/1  -----gktvlvTGat.GgiGsalaraLlarpGaeVvaldrltsagspeklealaaelgvefvqgDltdpe
00482931   1/1  -----nktvlvTGat.GgiGsalaraLlarGaeVvlldrlssgaseekleelaaelraaggpgvefvqgD
00468971   1/1  -----ktvlvTGat.GgiGsalaraLlarpGaeVvaldrlsspeklealaallgalgvefvqgDltdpes
00514911   1/1  ----SKtvlvTGat.GgiGsalaraLlerGaeVvlldrspekleellaeleallgggvefvqgDltdpes
00507211   1/1  -----ldmmslmgktvlvTGat.GgiGsalaraLlarGaeVvlldrspekleelaaelealggvefvqgD
00511831   1/1  llllmmmslegktvLVTGAt.GfiGsalvrrLlerGyeVvaldrspekleelaallealggdpgvelvvg
00465741   1/1  M...gktvlvTGat.GgiGsalaraLlarGaeVvlldrspsslllllekleelaaelealgggvefvqgD
00494281   1/1  ---emktvlitGAnR.GiGlelvkqllelakrgllviataRdpekaeeleelaaegsnlvilqldvtdee
00493571   1/1  ---llsllsslldllslkgktvlvTGat.GgiGsalaraLlarGaeVvlldrspekleelaaelealggs
00498641   1/1  -----krvLvTGgt.GfiGsalaraLlerGaevvvldrseekleelleeleallggrvefvegDltdpea
00367851   1/1  ---kgkkvlviGa..GgiGralaraLaeaGaevtvadrslekaealaaelggveavelDvtdeasldaal
00462911   1/1  ----skkvLvTGat.GfiGsalvrrLlerGyeVialdrlssgsneekleellkelellgpgvefvkgDlt
00491171   1/1  -----ktvlvTGat.GgiGsalaraLlallllslaGaevvaldrspseealealaellalggvefvqgDl
00532871   1/1  ---lsgktvlVtGAt.GgiGsalvrrLleagdvaevvalvrspekleelgg.gvevvvgDltdpdslaaa
00421801   1/1  ---DgigavsllkrllvdlpgkkvlvlGa..GgiGralalalaaagaevvvvnrtlekaeelaeelga..
00433371   1/1  -----ktvLVTGat.GfiGsalaraLlerGyrVvaldrdpekleellaelealgggvefvegDltdpesl
00485161   1/1  -----lsleeaAalplagltaylallllldlagllpgktvlvtGAa.ggiGsaaaqllaalGarViavdr
00464721   1/1  M...gktvlvtGat.GfiGsalaraLlarGaveVvaldrspe...............Dltdpeslaaala
00465291   1/1  -----PctplgvllllellgillllllmmlrlkgkvalVtGass.giGralAllLareGatVvvvdrnee
00479651   1/1  GkplvlggslgrseatgygvvysllaalkrllmglslegkvvlVtGaG..giGraiarrlaaeGakVvvt
00519251   1/1  -----kkkilvtGat.GfiGsalaraLlergyevialdrspekleellkllvefvkgDltdpesleealk
00496861   1/1  --AasilllgltsylallevlkikegkkVlvtGAt.GgiGlavvrlllkrGykViaidrseekleklkel
00527221   1/1  llllkillslkgkkvlvtGAt.GgiGralvkellargavskvialvRrpekleelaaegvevvvgDltdp
00371281   1/1  ------kvlVTGga.GfiGsalvraLlerGyeevvvldrlesgakl..gpgvefvegDltdpesleaale
00430411   1/1  M..sgkkvlvtGAt.GfiGshlaraLleaGhevvalvRspekaalalalelleelaapgvevvegDltdp
00383241   1/1  M...gkrvLvTGgt.GfiGshlvraLlerpGhevvvldrlpsgadallellalltlllslleklllllel
00387841   1/1  -----kkvlvtGAs.GgiGsalalllakegaevvlvdrdeekalealagelldlgggalvlvadvtdlea
00519911   1/1  lllllllimmmlkgkkvlvtGAt.GgiGralvkeLlergavskVtalvRrpekleelaaegvevvvgDlt
00400431   1/1  M...gkkvLvTGgt.GfiGsalvraLlerGaevvvldrdpegaaellallealggprvefvagDltdpea
00419991   1/1  -----kkvLvTGgt.GfiGshlaraLlerGaevvvldrlsegaeellaelealgprvefvkgDltdpeal
00430421   1/1  M..kgmkvlvtGgt.GfiGshlvraLleaGhevvvlvRnpskgkaaklelleellglgvevvegDltdpe
00481861   1/1  -----kkvlvtGAs.GgiGsalalllaargaevvlldrspeklegvaldlsdlgvevvvadltdpeslae
00484141   1/1  -----ktvliiGa..GgvGlaiaqalaalGakkVvlvdrdeekaqalveqlkelgskikvkavsldvgdv
00354771   1/1  -MlkgmkvlVtGAa.GgiGsalalrlaarglagldllvevvlldrsealealegvaldlsdgalavlldl
00521161   1/1  MslllllllllmlkgmkilVTGaa.GfiGshlvrrLlerGyevvaldrspekleelldpgvefvegDltd
00405511   1/1  -----ktvlvtGa..GgvGlaaaqlaaalGarViavdrseeklelarelgad.vvidvtdedlveavlel
00502281   1/1  ----mmkvlitGAt.GfiGselvrlLlehgdhevtaldrrtsagkllnepgvevvegdltdpddlekalk
00348721   1/1  -----kvavVtGas.rgiGraiallLaaagatVtvcdrdtedleelvke.adivvtavgvpdlvkael..
00429061   1/1  ----aklkpgktvlvtGAa.ggvGlaaaqlakalGarViatarseeklellkelGa.dvvidykd....e
00352901   1/1  -----fgalnlgrlllgllglvpctplgilellerlgidlsgkvalVtG.asggiGraiallLaraGatV
00519961   1/1  -----MkvLvtGat.GfiGshlvrrLlerghleVvgldrlssgleellelpgvefvegDltdpealeeal
00471781   1/1  -----mmmmkvlvtGAt.GfiGsalvrelleagheVtalvRdpsklaallglgvevvvgDltdpaslaaa
00484551   1/1  ---DgiGfvellkrlgvdlkgktvlitGA..Ggagraialalaklg.nvvianrtlekaealaeelgelg
00516961   1/1  ---kgkrvlvtGAt.GfiGshlvrrLlaeghvsevvalvrrpsk....llpgvevvvgDltdp..laeal
00423401   1/1  -----aGylavllaalllcrflgglgllltlagglagkkvlviGa..GgvGlaaarllaalGakVtvldr
00367461   1/1  -----ktVlviGa..GgiGlaaalaakalGakViatdrspekleqakelga.dfvvvykdlsediieava
00484691   1/1  ---DgigavsllkrlgvdlpgkrvlviGa..Ggagraaalallalgaevtvvnrtlekaeelaellad..
00491981   1/1  -----lnpsemkgkrvlvtGgt.GfiGsnlaelLlergyevvgldrsepglnslldllllaeniafvkgD
00360071   1/1  lellllialenllllllllllellllsllkpmkVlVtGAa.GfiGshlalrLlsgglagldqlvevvlld
00374371   1/1  -----agrlavleaalllervltglgalagllpgkrvlViGa..GgiGleaAaalarlGakVtvvdrrpe
00482271   1/1  -----mkiaviGa..GyvGlplAallaeaGheVvgvDideekvealnd..gilpilepgleellrdllda
00470321   1/1  -----llGdntdglgavellerlggdlkgktvlviGa..GgiGravaralaaaGakrvvvanrtpekaee
00513271   1/1  -----dtVlviGa..GgvGllaiqlakalGagrViatdispeklelakelGa.dhvinyrd....edlve
00432761   1/1  ----lplelaaalglalltavlavlaagvkpgktvlvlGa..GgvGlaaaqlakalGakVvavdiseekl
00387111   1/1  ----pgltAyvglleiakvkpgetVlvlGa..GgvGllavqlaklaGagrviavdgsdeklelakelGa.
00502031   1/1  -----dtVlvlGa..GgvGllavqlakalGasrViatdrspeklelakelGa.dhvinykdedl.ldlve
00472761   1/1  ysrplllgligllgakvlpgkkvaviGa..GgvGlalAlalaaagaagevtlvDideekleglardlldi
00383791   1/1  -----pkdvdlrvllllpeigltalealkrallelkpgsrVlviGa..GgvGsaaaqllaaaGvgkvilv
00467251   1/1  -vkpgdtVlvlGa..GgvGllaiqlAkalgasrViavdlseeklelakelGa.dhvinykd....edlve
00476551   1/1  -vkpgdtVlvlGa..GgvGllavqlAkalGasrViavdgspeklelakelGa.dhvinykd....edlve
00481071   1/1  -vkpgdtVlvlGa..GgvGllavqlAkalGasrviavdlsdeklelakelGa.dhvinykded..edlve
00445261   1/1  ----pkslpllelallltglltawlplllagllpgktvgviGl..GgiGlavarlakalGarViaydrsp
00509101   1/1  -----mkigiiGa..GnmGralaagLlkaGhsevtvanrtpekaealaeeg...gvvaaslaealad---
00423661   1/1  ----lplelgalvltlatavralllagvlpgakVlvlGa..GvvGlqaaalakalGageVtvvDisperl
00461141   1/1  -vkpgdtVlvlGa..GgvGllavqlAkalgasrviavdlspeklelakelGa.dhvinpkded..edlve
00530191   1/1  ---kmmkvavtGAt.GyiGralvrlLlerghpvvalvrlassasa..gkgvevvlgdltdldllaaala.
00486731   1/1  -vkpgdtVlvlGa..GgvGllavqlAkalGasrViavdlseeklelakelGa.devinykded..kdlve
00502041   1/1  -lspgetvlvhGAa.GgVGllavqlAkalGasrViatagseeklellvkelGa.devinyke....edlv
00502691   1/1  -----kkvgiiGl..GlmGlalarnlaaaGyeVvvydrspeklealaalgaeva----------------
00512641   1/1  -lkpgetVlvhGAa.GgvGlaavqlAkalGarViatagseeklelakelGa.dhvidyrd....edlvea
00462531   1/1  -----dtVlvlGa..GgvGllavqlAkalGasrViavdlseeklelakelGa.dhvinykdl...edlve
00528371   1/1  -----mkkvgiiGl..GlmGlslalalaraGfadeVvgydrnpeklekalelgatdliaatdlaeal---
00487991   1/1  -eeAAalplagltaylalveraglkpgetVlvtgaa.GgvGlaavqlAkalGarviatagseeklelake
00474811   1/1  -----dtVlvtGAa.GgvGlaavqlakalGarViatdrspeklelakelGa.dhvidyrd........ed
00508901   1/1  -lkpgetvlvtGAa.GgvGslavqlAkalGarViatagseeklellrelGadevi....dyk...dlvee
00517971   1/1  -----mkigiiGa..GnmGsalakgllkaghevvvadrspekaeelaeelgvta----------------
00488631   1/1  -vkpgdtVlviGa..GgvGllavqlAkalGarViavdrseeklelakelG.adhvidykeedlvaell..
00445591   1/1  ----pkkvaviGa..GgvGlalAlllaaagggdVtlvDidpekleglaadlldilelllverlitttdle
00479921   1/1  -----pkkvaviGa..GavGlalAlalaraGaageVvlvdrdeerlealaadledllellgvdlrattdl
00367441   1/1  ---llglafgtgfllllelagvlpgktVlvfGl..GgvGlaaillakaaGagrviavdlndeklelaksl
00355351   1/1  ----GkkvaviGl..GsmGlalAallaaaGheVlvwdrdpekveelaelgapvak---------------
00385671   1/1  -----lplellallGcglltaliglvevaklkpGktvlvlGl..GgvGllalllakaaGagrvigvdind
00473461   1/1  --klkmhviiiGa..grvGrslarlLleegidvvvidrdperveelaeelellgvlvivgdatdpev---
00487551   1/1  ----mmkigviGl..GlmGlplalnlakagheVvvydrnpekvealkelgapile..lknltaatsl---
00456451   1/1  mienlllllelllelellkslkkpmkvlvtGAa.GfiGshlallLasgglagldqvvelvlldiveslgk


                         -         -         *         -         -         -         -:140
query           ILNKTGGSLDVIFNNAGYGQAGALEDIDTKFLKQQFETNVFGLHNLTYKALKIMRKQGYGKIIQHSSVLG
00476811   1/1  tdeesvealveav...efgrldiLvnnAGialpgpleelsledwervldvNllgtflltraalplmrkrg
00515681   1/1  ealveavleefg.rldilvnnaGillplgplldlsledfervldvnllgtflltraalplmrkrgggriv
00503651   1/1  ealveeileefg.rldilvnnagillpgplldlsledwervldvnllgvflltkaalplllmrkrgggri
00509671   1/1  deesvealveevleefg.rldilvnnAgialpgpgllldlsledfervldvnllgtflltraalplmlkr
00383421   1/1  Dvtdeesvealveaaleefg.rldilvnnAgilldgplleltledwervldvnllgtflltraalplmrk
00450761   1/1  avalDvtdeesvealveavleefg.rldilvnnAgillpgpleelsledfervldvnllgtflltraalp
00532861   1/1  deesvealveeileefggrldilvnnagilllgplldlsledwervldvnllgvflltkaalplmrkrgg
00513551   1/1  ealveeileefgrlgldilvnnAgillplgplldlsledfervldvNllgtflltkaalplmkkrgalss
00515421   1/1  valDvtdeesvaalvaavleefg.rldilvnnAGilldgpleeltledwervldvnllgaflltraalpl
00354711   1/1  veavleefg.gldvlvnnAgillvlllllgpledlsledwervldvNvlgtflltraalplmrkag.gri
00510061   1/1  esvealveavleefg.rldilvnnaGialpgplegslldlsledfervldvnllgtflltraalplmlkr
00512031   1/1  tdeesvealveeileefg.rldilvlnnAGillpgpled.sledwervldvNllgtflltkaalplm.kr
00510931   1/1  avalDvtdeesvealveavleefg.rldilvnnAgillpgpledltledwervldvNllgvflltraalp
00437031   1/1  esvealveavleefg.rldilvnnagillpllllgplldlsledfervldvnllgvflltraalpllrkr
00376621   1/1  tdeesvealveaileefg.rldilvnnagillp.pllelsledfervldvnllgvflltraalplmrkrg
00507761   1/1  svealveevleefg.rldilvnnagialpgplldlsledfervldvnllgtflltraalplmrkrgggri
00464831   1/1  lelleleleelleleleesvealveeileefg.rldilvnnAGialpgpllllkslllsellgslldlsl
00350181   1/1  vealveavleefggrldilvnnagillpgplldltledfervldvnllgtflltraalpllrkrgggriv
00512601   1/1  svealveevleefg.rldilvnnAgillvgplldlsledfervldvnllgtflltraalplmrkrgggri
00421311   1/1  laeeleelelllllllesvealveaalerfg.rldilvnnAgialvgallglllllllllkplldlsled
00509551   1/1  vtdeesvaalvaavleefg.rldilvnnAgillpgpllelsledwervldvnllgtflltraalplmrkr
00471241   1/1  deesvealveavleefg.rldilvnnAgillpgplleltledfervldvnllgvflltraalplmrkrgl
00511091   1/1  aaDvtdeesvealveeileefg.rldilvnnAgillpdgpled.sledfervldvNvlgtflltraalp.
00517631   1/1  eef.....grldilvnnagillvgplldlsledfervldvnllgtflltraalpllrkrgggrivnisSv
00515111   1/1  deesvealveavlellleefgrldilvnnAGillplllgplleltledwdrvldvnllgvflltraalpl
00424291   1/1  aveel.....ggldvlvnnagiallgplldlsledfervldvnllgtflltraalplmrkaglggrivni
00532661   1/1  eesvealveeileefg.rldilvnnaGiagklellgplldlsledwervldvnllgtflltkaalplm..
00361941   1/1  eel.....ggldvlvnnagialpgplldlsledfervldvnllgtflltraalplmrkrglggrivniss
00499431   1/1  deesvealveeileefg.rldilvnnaGiaglslllgplldlsledwervldvnllgvflltkaalplm.
00506551   1/1  eesvealveeileefg.rldilvnnAGil.vgpledlsleldfervldvNllgtflltkallplmkks..
00523681   1/1  lveeileefg.rldilvnnagilllgplldlsledwervldvnllgvflltkaalplmrkrgggrivnis
00451531   1/1  esvealveaileefggrldilvnnagillpgplldltledfervldvnllgvflltraalplmrkrgggr
00368061   1/1  veaaleefg.rldilvnnAgillpllllllgplldlsledfervldvnllgtflltraalplmrkrgaes
00380421   1/1  esvealveaaleefg.rldilvnnagillpgplldlsledfervldvnllgtflltraalplmrkrglgg
00502371   1/1  vealveavleefg.rldilvnnagillpgplldlsledfervldvnllgvflltraalpllrkrgggriv
00525291   1/1  ealveavleefg.rldilvnnagillpgplldlsledfervldvnllgvflltraalpllrkrgggrivn
00394381   1/1  svealveavleefg.rldilvnnagillpgplldlsledfervldvnllgtflltraalplmlkr..gri
00380681   1/1  aalveavleefg.rldilvnnagillvgplldlsledfervldvnllgtflltraalplmrkrglggriv
00369221   1/1  vealvaavleefg.rldilvnnagilldgplldltledfervldvnllgtflltraalplmrkrgggriv
00514401   1/1  avalDvtdeesvealveeileefg.rldilvnnAgilavgpledlsledfervldvNvlgtflltraalp
00387701   1/1  lveavleefg.rldilvnnAgialpgplldlsledfervldvnllgtflltraalplmrkrg.grivnis
00519651   1/1  ealveevleefg.rldilvnnAgilgpllgplldlsledfervldvnllgtflltraalplmrkrgggri
00499021   1/1  kllellaallelsdleggkalavaaDvtdeesvealvdaivekfg.rldiLvnnagiagellgplldlsl
00413661   1/1  lveavleefg.rldilvnnagillpgplldlsledfervldvnllgtflltraalpllrkrgggrivnis
00520851   1/1  Dvtdeesvealveavleefg.rldilvnnagillpgplldlsledfervldvnllgtflltraalpllrk
00512791   1/1  ealveavleefg.rldilvnnagillvlgplldlsledwervldvnllgtflltraalplmrkrg.griv
00436781   1/1  vaaaleefg.rldilvnnAgillpllllllgplldlsledfervldvnllgtflltraalplmrkrgaes
00482861   1/1  vealveevleefg.rldilvnnAGil..gpledlsledfllervldvNvlgtflltraalplllk..ggr
00353051   1/1  svealveevleefg.rldilvnnAGi........lsledwervldvNllgvflltraalplmrkrglglg
00398711   1/1  vaavleefg.rldilvnnAgillvgplldlsledfervldvnllgtflltraalplmrkrglggrivnis
00388141   1/1  vaavleefg.rldilvnnagvlldgplldltledfervldvnllgtflltraalpllrkrgggrivnisS
00519551   1/1  vtdeesvealveeileefg.rldilvnnagillpgplldlsledwervldvnllgvflltkaalplmkkr
00489491   1/1  tdeesvealveeileefg.rldilvnnaGildldllllgplldlsledwervldvnllgvflltkaalpl
00385451   1/1  vaealeefg.rldilvnnAgillvgplldlsledfervldvnllgtflltraalpllrkrgggrivnisS
00474701   1/1  eesvealveavleefg.rldilvnnagillplgplldlsledfervldvnllgvflltraalpllrkrgg
00499421   1/1  avleefg.rldilvnnagilldgplldltledfdrvldvnllgtflltraalplmrkrgggrivnisSva
00498451   1/1  ale..fgrldilvnnAgillpllllgplldlsledwdrvldvnllgtflltraalplmrkrgaasggggg
00468011   1/1  vleefggrldilvnnAGialpgpll.......ervldvNllgtflltraalpllrkrgggrivnisSlav
00416101   1/1  ealveavleefg.rldilvnnagillpgplldltledfervldvnllgtflltraalplmrkrglggriv
00503831   1/1  laaeleallggrvlavalDvtdeesvealveeileefg.rldilvnnAgilavgpledlsledfervldv
00417571   1/1  tdeesvealveavlellleefg.rldilvnnAGillplllgpllelsledwdrvldvnllgvflltraal
00425051   1/1  aveefg.rldiLvnnagialllgplldlsledwdrvldvnllgvflltraalplmlkrgggrivnisSva
00517021   1/1  vaavleefg.rldilvnnagilllgplldlsledwdrvldvnllgtflltraalplmlkr..grivnisS
00482431   1/1  svlellealveavleefg.rldilvnnaGialpgpllgllllllllldlsleadwervldvnllgvfllt
00409101   1/1  delesvealveealeefg.ridilvnnAGi........lsledwervldvNllgtflltraalplmrkrg
00500221   1/1  aavleefg.rldilvnnagilllgplldltledfdrvldvnllgvflltraalplmrkrgggrivnisSv
00528731   1/1  esvealveevleefg.rldilvnnaGil........sledfervldvnllgtflltraalpllrkrglgg
00529881   1/1  ealvaaavellgefgrldilvnnagialllllllgplldlsledwdrvldvnllgvflltraalplmre.
00465921   1/1  leelleleaaleeleeleggralavaaDvtdeesvealvaaaveefg.rldiLvnnagiallllgplldl
00416921   1/1  aaleafgrldilvnnagiallgplldlsledwdrvldvnllgvflltraalplmlkrgggrivnissvag
00486141   1/1  aveafg.gldvlvnnagillplgplldlsledwdrvldvnllgtflllraalpllvk.g.grivnisSva
00483611   1/1  elleleaaleeledleggkalavaaDvtdeesvealvdaaverfg.rldiLvnnagialllggplldlsl
00480351   1/1  aelgalgralavaadvtdpesvealv........ggldilvnnagilgallgplldltledwervldvnl
00385591   1/1  avellefggldvlvnnagilavgeplldlsledwdrvldvnllgtflllraalplmvk.g.grivnissv
00527441   1/1  vaaDvtdpesvealvaeileef..gldvlvnnAgillvgpledlsledfervldvnvlgtfnllraalpl
00490261   1/1  ggrvefvegDltdpesleaaleev......gvDvvvhnAgissvgpse.ltledpeevldvNvlgtlnll
00495191   1/1  ltdpeslaaalagv......rldvvvhnAgivgv....dlseedpeevldvNvlgtlnlleaalpagvks
00460341   1/1  slaaalagv......riDvvihnAgivsv....dlseedpeevldvNvlgtlnlleaalpagvkrggggg
00482931   1/1  ltdpeslaaalagv......rldvvvhnAgissv....dlseedpeevldvNvlgtlnlleaalpagvkr
00468971   1/1  laaalagv......ridvvihnAgiv....lvdlseedpeevldvNvlgtlnlleaalpagvkrgggggl
00514911   1/1  laaaleev......gvdvvvhnAgivgv....dlseedpeevldvNvlgtlnlleaalpa....gvgriv
00507211   1/1  ltdpeslaaalagv......riDvvvhnAgi....plvdlseedpeevldvNvlgtlnlleaa....rka
00511831   1/1  Dltdpesleaale........gvdvvihlAgiasvg.......edpeelidvNvlg....tlnlleaark
00465741   1/1  ltdpeslaaaleev......gvdvvihnAgi....plvdlseedpeevldvNvlgtlnlleaalpa....
00494281   1/1  sieelaaeveellgdggldvlinnAGillpsgslgeldleellevfevnvlgpllltqallpllkkgaak
00493571   1/1  lllggvefvqgDltdpesleaala........gvdvvvhnAgivgv....dlseedpeevldvNvlgtln
00498641   1/1  leaaleev......gvdvvihlAgissv....dlseedpeevldvNvlg....tlnlleaarkagvgriv
00367851   1/1  ........gdaDvvinaapvglhaeiveaaleagkhvvdenpla..aetralleaakeagvgrivnvssa
00462911   1/1  dpesleealkgv......kpdvvihlAaivhv....dlseedpeetidvNvlgtlnlleaarkagvksg.
00491171   1/1  tdpeslaaala........gvdvvvhnAgivsv....dlseedpeevldvNvlgtln....lleaarkag
00532871   1/1  la........gvdavvhlagivgvgalllllllksllelseedpeevldvnvlg....tlnlleaakaag
00421801   1/1  qgdvsdleeleeal........ggaDivvnatgaglpglllelllellkpggvvvdvaypp..llttall
00433371   1/1  aaalagv......rpdvvvhlAalssv....dlseedpeevldvNvlgtlnl....leaareagvvgriv
00485161   1/1  seeklellkelgad.vvidvtdedaveal.......agggvdvvvnnaggatlgallel.lapggrvvlv
00464721   1/1  gv......rvdvvihlAgivsav...dlseedpeevldvNvlg....tlnlleaarkagvkrivfvSSia
00465291   1/1  kleelaeeieaaggkavvldvsdeedlkelv........grlDilvnnagipllkplldltkegwdvidv
00479651   1/1  dinpealeaaaaelgaevvsggealavacdvtdpaavealidaavaafg.kldilvnnAgiplvdpeall
00519251   1/1  g........vdvvihlAaivgv....dlseedpeetidvNvlg....tlnlleaarkagv.rfvfiSSsa
00496861   1/1  gad.vvldvtd...veellkallk..lggvdvvihtag....apvtelslsllkqllrvnvlgtlnllra
00527221   1/1  eslaealk........gvdvvinaagttrfg.......edleeflavnvdg....tlnlaeaakkagvkr
00371281   1/1  ev..ekfggvdvvihlAaissvd..es....dpeelldvNvlg....tlnlleaarkagv.rfvytSSaa
00430411   1/1  eslaealk........gvdvVihlag...................dvnvlg....tlnlleaakkagvkr
00383241   1/1  lgprvefvegDltdpealaaala.....efggvdvVihlAalvhv....dlseedpeevldvNvlgtlnl
00387841   1/1  vedlveal.....ggadvvvnnagvp......rkpgeerldllevnvlg....tknlaealkkagpgriv
00519911   1/1  dpeslaaalk........gvdvvinaagitrvg.......edleefldvnvdg....tlnlldaakkagv
00400431   1/1  leaala........gvdaVvhlAalshv....dlseedpeevlevNvlgtlnlleaarka....gv.rfv
00419991   1/1  aalleei......gvdaVihlAaissv....dlseedpeevldvNvlg....tlnlleaarkagvkprfv
00430421   1/1  slaealk........gvDvVihlagl...............evidvnvlg....tlnlleaakeagnvkr
00481861   1/1  alkg........advvviaagip......rkpgedrldlldvnvlgvknlleaaaka....gvgrivlvs
00484141   1/1  eeleell........gkvDivinaaglgepaklldllvellervksgnvlgdlllapevlplleeasekg
00354771   1/1  tdtddlaealk........gadvvvhlagv......prkpgedrddllavnvlg....tralleaarkag
00521161   1/1  pealeeale........gvdaVihlAalssvg...eseedppleflevNvlg....tlnlleaarkagvk
00405511   1/1  t.....ggvDvvvdaagvpatleealrllkpggrlvlvgvaggllpldlarlllkgvnlrgs--------
00502281   1/1  ........gvDvvihaagtsrvdeslkdal.......gtnvigtssalrllnlleaakeagvkrfvhvst
00348721   1/1  ......gkpgalVnnaGinrl..fdeetledwllvgdvnllgvlllarailpvpggvgpgtivnllsnlg
00429061   1/1  dlvealkeltggrgvdvvlnnvggetldaaldllapg.grvvlvglisgynlpllllllllkglt-----
00352901   1/1  tvtdrntenleeavkeaDivivavgvpglvkaellkpgavv-----------------------------
00519961   1/1  ak.......gvdaVihlAalvsv....deseedplefievnvlgtlnl....leaarkag.krfvfaSsa
00471781   1/1  la........gvdaVihlag...........padpldllevnvdgtrnl....leaakaagvkrlvlvss
00484551   1/1  gavkvdvldlddlaealg........gadilinatgagmpplledllpldlalllkvnvvldlayt----
00516961   1/1  ag........vdvvihlagvvrf......sagdpeaflavnvdgtlnl....leaaraagvkrfvlvSsl
00423401   1/1  npekleqleelgadavevdvsdtadleelvae--------------------------------------
00367461   1/1  ellatngggadividtagi---------------------------------------------------
00484691   1/1  evvaldlddleeal........ggaDlvinatgagmaglvlplllsllkpggvvvdvgypplitpllala
00491981   1/1  lsdkealkraladv......kpdvVihlAavsgp....rvsaadpeavydtnvlgtlnllea....akka
00360071   1/1  rleslekleglaldlsdaatfllgdvsdtadleealk........gadvvvhlAgvp......rkpgmdr
00374371   1/1  llerleelgakfvlltldeelvevvlaltvdvsdeegrlkavetleellgeaDvvivaagippa......
00482271   1/1  grltattdlaealadadvviiavgtpldadg............gadlsyvlaaaralakvlkklgvgaiv
00470321   1/1  laeel...............ggeavsldelaealaeaDivinatpaglpvitlell--------------
00513271   1/1  avleltggrgvdvvidav----------------------------------------------------
00432761   1/1  elakelGadfvvvykd..edvaeavleltg...-------------------------------------
00387111   1/1  davvnykdl...edlaealke-------------------------------------------------
00502031   1/1  avkeltggrgvdvvldav----------------------------------------------------
00472761   1/1  lellgvglvvttdleea-----------------------------------------------------
00383791   1/1  Drdeealerarrlgp....---------------------------------------------------
00467251   1/1  avkeltgggvdvvldavggpa-------------------------------------------------
00476551   1/1  avleltggrgvdvvldavgge-------------------------------------------------
00481071   1/1  avkeltgggvdvvldavg----------------------------------------------------
00445261   1/1  eklelakelgadfvvvysd..-------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00423661   1/1  eqaeelGadlvvvpse..edlaeavreltgkqgggaDlvitaagipg.......................
00461141   1/1  avkeltgggvdvvleavgapa-------------------------------------------------
00530191   1/1  .......gvdvvflaaga..........................gatlalaeaaaaagv.kvidlssafr
00486731   1/1  avkeltgggvdvvldavggpa-------------------------------------------------
00502041   1/1  ealkeltgggvdvvldt-----------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00512641   1/1  vkeltggrgvdvvldtv-----------------------------------------------------
00462531   1/1  avkeltggrgvdvvidavgge-------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00487991   1/1  lGa.dhvinykd....edfveavleltggrgvdvvldavg....getleaaldllapgGrvvlvGlasga
00474811   1/1  laltggggvdvvldtvgg.....tleaaldllrpgGrlvlvgllsggplplpllllllkgltllgsllgs
00508901   1/1  vleltggegvdvvldtvg.ge-------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00488631   1/1  .....gggvdvvldtvggp---------------------------------------------------
00445591   1/1  eala.....daDvviia-----------------------------------------------------
00479921   1/1  eealk.....daDlvii-----------------------------------------------------
00367441   1/1  G.adlvvnpkdld..eevaea-------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00385671   1/1  eklelakelGathvv....nyketekvaeevkeltdgegvdvvieavgsp..........qtlreaisvl
00473461   1/1  ----------------------------------------------------------------------
00487551   1/1  ----------------------------------------------------------------------
00456451   1/1  legvaldlsdaafpllgdvtvgtdlyeafk........gadvvvhlAgvpr......kpgmdrldllktn


                         +         -         -         -         -         *         -:210
query           LVAMKYRGAYNASKYAIEGLTDTMRLELRDSNIFITSLNTGPITSKFRENSIKTITNVNYDSSVHKQQYE
00476811   1/1  ggrivnisSvagllglpglaaYaasKaalegltrslalelaptgirvnavaPGlvdTpllrallaalall
00515681   1/1  nisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTp-----------------
00503651   1/1  vnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdTpllrgllgllallllll
00509671   1/1  g.grivnisSlvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllalll
00383421   1/1  rglgrivnisSvagllglpgqaaYaasKaalegltrslalelaprgirvnavapglvatplterllrl..
00450761   1/1  lmlkr..grivnisSvaglllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpmlaal
00532861   1/1  grivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdTpllrglld......
00513551   1/1  gellslgggrivnisSiagllglpglgllelplaaYaasKaalegltrslalelapkgirvnavapglvd
00515421   1/1  mrkrgggrivnisSvagllglpgqaaYaasKaallgltrslalelaprgirvnavaPGlvdTpmtaalle
00354711   1/1  vnisSvaglgglpglaaYaasKaalegltrslarelap.girvnavapglvdtpllrglllpllllalll
00510061   1/1  g.grivnisSlvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllapee
00512031   1/1  gggrivnisSiagllglpgqaaYaasKaalegltrslalelllapkgirvnavaPGlvdtpllaalllal
00510931   1/1  .mlkrgggrivnisSvagllglpglaaYaasKaalegltrslalelaprglgirvnavaPGlvdTpllrg
00437031   1/1  g.grivnisSvagllvglpglaaYaasKaalegltrslalelaptgirvnavaPglvdTpllrglllll.
00376621   1/1  ggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnava-------------------
00507761   1/1  vnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapgl--------------------
00464831   1/1  edwer.ldvNllgvflltkaalplmkkaaklskrgggrivnisSvaglrglpglaaYsasKaalegltrs
00350181   1/1  nisSvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpllaallll.........
00512601   1/1  vnisSvagllglpglaaYaasKaalegltrslalelaplgltgirvnavapglvdtpllaallaa.....
00421311   1/1  wdrvldvnllgtflltraalplmrkrsaessggggrivnisSvagllglpglaaYaasKaalegltrsla
00509551   1/1  gldggrivnisSvagllglpllglaaYaasKaalegltrslalelllaprgirvnavapglvdtpllral
00471241   1/1  ggrivnisSvagllallllllglpglaaYaasKaallgltrslalelaprgirvnavaPglvdTpllagl
00511091   1/1  lrkrglgrivnisSiagllglpgqaaYaasKaalealtrslalelallprgirvnavaPGlvdtp.....
00517631   1/1  aglllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllrgllpll...........l
00515111   1/1  mrkrgllggrivnisSvagllglpglaaYaasKaallgltrslalel..tgirvnavaPglvdTdllaal
00424291   1/1  ssvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvltpllralll............
00532661   1/1  rgggrivnisSiagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdTpllrgl.....
00361941   1/1  vagllglpglaaYaasKaalegltrslalelaprgirvnavapglvatpllr------------------
00499431   1/1  .rgggrivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavaPglvdTpllrglll..
00506551   1/1  grivnisSiagllglpdlglllleelllddlllldllellslllelllealleelllglaaYaasKaale
00523681   1/1  SvagllglpglaaYaasKaalegltrslalelapkgirvnavaPglvdtpllrglll...........ll
00451531   1/1  ivnisSvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpllaalll........
00368061   1/1  gggggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllagllg..
00380421   1/1  rivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapg-------------------
00502371   1/1  nisSvagllgglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllagllld........
00525291   1/1  isSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllallgllg.........
00394381   1/1  vnisSvaglllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpllagllallllllll
00380681   1/1  nisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTp-----------------
00369221   1/1  nisSvagllglpgqaaYaasKaalealtrslalelaprgirvnavapglvdtpllaal............
00514401   1/1  llrkrgggrivni.SvagllglpgqaaYaasKaalegltrslalelaprgirvnavaPglvdTpllaall
00387701   1/1  SvagllglpglaaYaasKaalegltralalelaprglgirvnavapglva--------------------
00519651   1/1  vnisSvagllglpgllaaYaasKaalegltrslalelaprgirvnavaPglvdtplla------------
00499021   1/1  edwdrvldvnllgvflltkaalplmkk.g.gsIvnissiaglrglpglalayaasKaAlegltrslalel
00413661   1/1  SvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllealle-------------
00520851   1/1  rgggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllaal.....
00512791   1/1  nisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllll.........
00436781   1/1  glgggrivnisSvagllglpglaaYaasKaalegltrslarelaprgirvnavapglvatpllagllg..
00482861   1/1  ivnvsSvagllglpglddllleelllsdllllllldlllelldlllplledtplgplaaYaasKaalegl
00353051   1/1  grivnisSvagllglpglaaYaasKaalegltrslalelaptgirvnavaPglvdTpllaglll......
00398711   1/1  SvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvatplla-----------------
00388141   1/1  vagllglpgqaaYaasKaalealtrslalelaprgirvnavapglvatpllaalleellell--------
00519551   1/1  gggrivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdtpmlaallle...
00489491   1/1  m..rgggrivnissvagllglpglaaYaasKaalegltrslalelapkgirvnavaPglvdTpllrglll
00385451   1/1  vagllglpglaaYaasKaalealtrslalelaprgirvnavapglvatpl--------------------
00474701   1/1  grivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrg---------
00499421   1/1  gl.glpgqaaYaasKaalegltrslalelaprgirvnavapglvdtplla--------------------
00498451   1/1  rivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllagllp.......
00468011   1/1  ygalldlpllelllllllldlledvaglrglplglaaYaasKaalegltrslalelaprgirvnavaPgl
00416101   1/1  nisSvagllglpglaaYaasKaalegltrslalelllaprgirvnavapgl-------------------
00503831   1/1  NllgtflltraalplllkrglggrivnisSvagllglpgqaaYaasKaalegltrslalelaprgirvna
00417571   1/1  plmrkrgllggrivnisSvagllglpglaaYaasKaallgltrslalel..tgirvnavaPglvdTdlla
00425051   1/1  glvglpglaaYaasKaallgltrslalelaprgirvnavaPglvdTpmlaalllgl.........lllll
00517021   1/1  vagl.glpglaaYaasKaalegltrslalelaprgirvnavapglvdtpl--------------------
00482431   1/1  raalp..llrggglssglggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavaP
00409101   1/1  lglggrivnisSvagllglpglaaYaasKaalegltrslalelaptgirv--------------------
00500221   1/1  agllglpgqaaYaasKaalealtrslalelaprgirvnavapglvdtpll--------------------
00528731   1/1  ggrivnisSvagllglpglaaYaasKaalegltrslalllelaptgirvnavapglvrtpllagllpll.
00529881   1/1  g.gsivnissv.gllglpglaayaasKaalegltrslalelaprgirVnavaPgpirTpllaallaalaa
00465921   1/1  sledwdrvldvnllgvflltraalplm..rgggsivnissvaglvglpglalayaasKaAlegltrslal
00416921   1/1  llglpglaaYaasKaalegltrslalelaprgirvnavaPglvdTpllagl-------------------
00486141   1/1  gygplpglaaYaasKaavegltrslalelapllkgirvnavapglvdtpllra.................
00483611   1/1  edwdrvldvnllgvflltqaalplmkk.g.gsIvnissiaglvglpglalayaasKaAlegltrslalel
00480351   1/1  lgtflltraalplmlarg.grivnissiagllglpglaaYaas---------------------------
00385591   1/1  aglgglpglaaYgasKaavegltrslalelapllkgirvnavapgnvdt---------------------
00527441   1/1  ....gvgrivniSSiagvlgspgqsaYaasKaalealtrslaae....girvnavrpglvatpglveel.
00490261   1/1  eaalpa....gvggrivfvSSiavygdpdgpidEddlllvllllllllltplpplsaYgasKaaaelllr
00495191   1/1  g.grivniSSiavygdpeglpidEdtplpplspYgasKaaaeallral----------------------
00460341   1/1  lslrivfiSsiavygglpgqsgpitEddpldplspYgasKaaaeallralarel..--------------
00482931   1/1  ggggrivniSSi.gvygdpggpidEddplnplsaYgasKaaaeallralarel...girvtilrpgnvyg
00468971   1/1  slrivfvSSiavyggpggllevllesllgpldeddplnplspYgasKaaaeallr---------------
00514911   1/1  fvSSiavyggllllppglpidEddplnplspYgasKaaaelllralare.apygirvt------------
00507211   1/1  gtvgrivnvSS.agvygdpglggpidEddpldplspYgasKaaaeallralarela--------------
00511831   1/1  agsvkrivfvSSiaavygdplllpglpidEdtwldvdllaalllllelplpplspYgasKaaaealaral
00465741   1/1  gvgrivfvSSiavygdpdglpidEgdpglpplspYgasKaaae---------------------------
00494281   1/1  ksgeglslsralivnissllGsigdntsgglyaYrasKaALnmltkslaielkdegilvvalhPGwvkTd
00493571   1/1  lleaalpa....gvgrivniSSi.gvyggpggapidEddplnplspYgasKaaae---------------
00498641   1/1  fiSSaavyggseegpidEddpldpplspYgasKaaaellaralarel..ygirvv---------------
00367851   1/1  agyadgrglpayqaakaalealllglalelgiagirvnailpgfvetpltllvvlv--------------
00462911   1/1  grfvfiSSsavyggppglpidEddplnplspYgasKaaaelllrayak----------------------
00491171   1/1  vgrivfvSSi.gvyggpgglpidEdtplpplspYgasKaaaeallralarel...g--------------
00532871   1/1  vkrivlvSslgayggdedtplpplspygasKaaaeallra.......sglrvtilrpglvlgpllsg...
00421801   1/1  plararglgrivdglsmlvlqgapgfely-----------------------------------------
00433371   1/1  fvSSaavyggppglpidEdtplnplspYgasKaaaellaralare...yglrvvilrp------------
00485161   1/1  nllggllltrallplllkrgkgrivns.........----------------------------------
00464721   1/1  vyggpgglpidEddllllplnplsapYgasKaaaelllralarel...glrvtilrpgn-----------
00465291   1/1  gvldvnllgvfll---------------------------------------------------------
00479651   1/1  illergilyaPdi---------------------------------------------------------
00519251   1/1  vygdpkkgpidEddllllnplnplspYgasKlaaekllrayakey-------------------------
00496861   1/1  llpllvklgvkrivyissv---------------------------------------------------
00527221   1/1  fvlvSslgalg..pspspyaasKaaaeallral.......glprvtivrpglvlgplgeplpge......
00371281   1/1  vyggppglpidEdtplnplspYgasKaaaellvralare...yglrvvilrpgnvygp------------
00430411   1/1  fvfvSsagvygdedtplpplspygasKaaaeallral.......glpvtivrpgnvygpglsg.......
00383241   1/1  ....leaarkagvkrfvfaSSaavyggnplllllddelpidEd---------------------------
00387841   1/1  vvsspagllglpalkvyga---------------------------------------------------
00519911   1/1  krfvlvSslgalg..pspspyaasKaaaeallral.......gldlvti---------------------
00400431   1/1  fiSSaavyggspllllllglllldglpidEdtpldplspYgas---------------------------
00419991   1/1  fiSSaavyggspgqpldesllldvdllpllaitEdtplnplsp---------------------------
00430421   1/1  fvfvSsagvygdedtplnplspygasKaaaekllra.......sglpvtilrpgnvy-------------
00481861   1/1  snpvdgl.....ayaaska---------------------------------------------------
00484141   1/1  irvvtglsilgeqgpaqltlyalskaa-------------------------------------------
00354771   1/1  vgrivvvssgnpvdilal----------------------------------------------------
00521161   1/1  rfvfaSSsa..vygdpeglpidEdtlldvdleplnplspYgas---------------------------
00405511   1/1  ----------------------------------------------------------------------
00502281   1/1  agvygllegvpelledallilnpnlyg-------------------------------------------
00348721   1/1  laagpglg--------------------------------------------------------------
00429061   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00519961   1/1  avygdpeglpidEddwld----------------------------------------------------
00471781   1/1  agaygdepgpplplspyaaskaaaeellra.......sgldytilrpgalfgpgrtgvl-----------
00484551   1/1  ----------------------------------------------------------------------
00516961   1/1  gaygd..plspyarsKaaaeallral..glprvtilrpglvygprdg-----------------------
00423401   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00484691   1/1  ravglrltvdglemlveqaalafelwtgi-----------------------------------------
00491981   1/1  gpvkrlvfvStagvygdvsa--------------------------------------------------
00360071   1/1  ldllkvnvkgtknllea-----------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00513271   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00387111   1/1  ----------------------------------------------------------------------
00502031   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00467251   1/1  ----------------------------------------------------------------------
00476551   1/1  ----------------------------------------------------------------------
00481071   1/1  ----------------------------------------------------------------------
00445261   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00423661   1/1  ..vlrealevmkpggvvvdvai------------------------------------------------
00461141   1/1  ----------------------------------------------------------------------
00530191   1/1  a....ddvpyglpkvnaeall-------------------------------------------------
00486731   1/1  ----------------------------------------------------------------------
00502041   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00512641   1/1  ----------------------------------------------------------------------
00462531   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00487991   1/1  ilplpllllllkgltllgsllgsrldlrell---------------------------------------
00474811   1/1  ......rlleelldllaegklkpvilit------------------------------------------
00508901   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00488631   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00367441   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00385671   1/1  kkpgGtvvlvgvpsgplellpivllvlssktvrgslvggr..............................
00473461   1/1  ----------------------------------------------------------------------
00487551   1/1  ----------------------------------------------------------------------
00456451   1/1  vkitknlleaaakagpk-----------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KILARQHKKVPFNEPAISVAKVVEKIINCDKPKPRYYITKATWIMTSLKRILPTNILDNFLNRY------
00476811   1/1  llllllllldllelleallaliplg.rlgtpeevaeavlflasdeapllsy-------------------
00515681   1/1  ----------------------------------------------------------------------
00503651   1/1  peeva-----------------------------------------------------------------
00509671   1/1  lllll-----------------------------------------------------------------
00383421   1/1  .......................gllllspeevaeallaallsgepvvvvgllllallllllee------
00450761   1/1  lllll-----------------------------------------------------------------
00532861   1/1  ..........eel---------------------------------------------------------
00513551   1/1  Tpll------------------------------------------------------------------
00515421   1/1  .........................plgrlgtpeevadavlflasdgayitgqvlvvdgglllv------
00354711   1/1  gellevlgdgiplg.rlgtpedvadavlflasdpeasyitgqvlnvdggltlsv----------------
00510061   1/1  lleal-----------------------------------------------------------------
00512031   1/1  alllllllalallllaallaaaaaalllllaall.....qvlvvdggll---------------------
00510931   1/1  llae.......................iplgrlgtpeevadavlflas..dgasyvtgqvlvvd------
00437031   1/1  .......lllllleelleallaliplg.rlgtpeevaeavlflas-------------------------
00376621   1/1  ----------------------------------------------------------------------
00507761   1/1  ----------------------------------------------------------------------
00464831   1/1  lalelapkgirv----------------------------------------------------------
00350181   1/1  ..lllleelleallaliplg.rlgtpeevaeavlflas.deasyitg-----------------------
00512601   1/1  .......................lgrlgtpedvaeavlflasdeasyitgq..gg---------------
00421311   1/1  lelaprgirvnavaPglvdTpmlral...........---------------------------------
00509551   1/1  l.................eelleallaliplg.rlgtpedvaeavlf-----------------------
00471241   1/1  .................peelleallaliplg.rlgt---------------------------------
00511091   1/1  ...........................................---------------------------
00517631   1/1  lpeelleallali---------------------------------------------------------
00515111   1/1  ll............dllleelleallaliplg.rlgtpeevaeav-------------------------
00424291   1/1  ...leellaallalipl.grlgtpedvadavlflasd---------------------------------
00532661   1/1  ..........llp---------------------------------------------------------
00361941   1/1  ----------------------------------------------------------------------
00499431   1/1  .............---------------------------------------------------------
00506551   1/1  gltrslalelllllapkgirvnavaPGlvdtpllrgll................----------------
00523681   1/1  llpeelleallkl---------------------------------------------------------
00451531   1/1  ....lllleelleallaliplg.rlgtpeevaeavlf---------------------------------
00368061   1/1  ...........-----------------------------------------------------------
00380421   1/1  ----------------------------------------------------------------------
00502371   1/1  .......eellea---------------------------------------------------------
00525291   1/1  ......peellelllaliprlgtpeeva------------------------------------------
00394381   1/1  lllpee----------------------------------------------------------------
00380681   1/1  ----------------------------------------------------------------------
00369221   1/1  .....leelleallaliplg.rlgtpeevaeavlflalsdeasyi-------------------------
00514401   1/1  l............---------------------------------------------------------
00387701   1/1  ----------------------------------------------------------------------
00519651   1/1  ----------------------------------------------------------------------
00499021   1/1  aprlgIrVnavaP---------------------------------------------------------
00413661   1/1  ----------------------------------------------------------------------
00520851   1/1  ............l---------------------------------------------------------
00512791   1/1  ..lllleelleallalipl.grlgtpeevadavlflasd..asyv-------------------------
00436781   1/1  ...............eellealldliplgrlgtpedvaeavlfla-------------------------
00482861   1/1  trslarelllllapkgirvnavaPglvdtpllrglla............................-----
00353051   1/1  ......dpelleallaliplgrlgtpeevaeavlflasd...yvtgqvlvvdggllll------------
00398711   1/1  ----------------------------------------------------------------------
00388141   1/1  ----------------------------------------------------------------------
00519551   1/1  ........................plgrlgtpeevaeavlflasdeasyi--------------------
00489491   1/1  .............---------------------------------------------------------
00385451   1/1  ----------------------------------------------------------------------
00474701   1/1  ----------------------------------------------------------------------
00499421   1/1  ----------------------------------------------------------------------
00498451   1/1  ..........eellallldgiplgrlgtpedvadavlflasd...-------------------------
00468011   1/1  vdTpll----------------------------------------------------------------
00416101   1/1  ----------------------------------------------------------------------
00503831   1/1  vapglvdTpllrg---------------------------------------------------------
00417571   1/1  all............lglldpelleallalipl.grlgtpeevadav-----------------------
00425051   1/1  eelleallalipl---------------------------------------------------------
00517021   1/1  ----------------------------------------------------------------------
00482431   1/1  glvdTpll...................lpeelleal----------------------------------
00409101   1/1  ----------------------------------------------------------------------
00500221   1/1  ----------------------------------------------------------------------
00528731   1/1  ........llllleellealldliplg.rlgtpedvaeavlflas-------------------------
00529881   1/1  lllllll---------------------------------------------------------------
00465921   1/1  elaprlgirVnav---------------------------------------------------------
00416921   1/1  ----------------------------------------------------------------------
00486141   1/1  .........lgdgtplgrlgtpedvaeavlflasdaaslyitgqvlnvdgglllsvl-------------
00483611   1/1  aprlgIrVnavaP---------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00385591   1/1  ----------------------------------------------------------------------
00527441   1/1  ...................laellariplgrl..tpedvaravlfllsda...y----------------
00490261   1/1  alarel...girvtilrpgnvygpglrplgligel-----------------------------------
00495191   1/1  ----------------------------------------------------------------------
00460341   1/1  ----------------------------------------------------------------------
00482931   1/1  p........ggrpglvtsllplflrlalaglpltlvlgdgd-----------------------------
00468971   1/1  ----------------------------------------------------------------------
00514911   1/1  ----------------------------------------------------------------------
00507211   1/1  ----------------------------------------------------------------------
00511831   1/1  arelap.glrvvilrpgnvygpglrptlvt........sl------------------------------
00465741   1/1  ----------------------------------------------------------------------
00494281   1/1  mggpnalltvee----------------------------------------------------------
00493571   1/1  ----------------------------------------------------------------------
00498641   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00462911   1/1  ----------------------------------------------------------------------
00491171   1/1  ----------------------------------------------------------------------
00532871   1/1  ....................lrlggllllgdgdalrsfisvedvada-----------------------
00421801   1/1  ----------------------------------------------------------------------
00433371   1/1  ----------------------------------------------------------------------
00485161   1/1  ----------------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00479651   1/1  ----------------------------------------------------------------------
00519251   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00527221   1/1  ....lllaggllllgdgdakrspisvddvaralvaaledp------------------------------
00371281   1/1  ----------------------------------------------------------------------
00430411   1/1  .......iplllrlalkggpllilgdgdakrdfvhveDvaravvlaledpeatgkv--------------
00383241   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00519911   1/1  ----------------------------------------------------------------------
00400431   1/1  ----------------------------------------------------------------------
00419991   1/1  ----------------------------------------------------------------------
00430421   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00521161   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00348721   1/1  ----------------------------------------------------------------------
00429061   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00519961   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00484551   1/1  ----------------------------------------------------------------------
00516961   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00491981   1/1  ----------------------------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00513271   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00387111   1/1  ----------------------------------------------------------------------
00502031   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00467251   1/1  ----------------------------------------------------------------------
00476551   1/1  ----------------------------------------------------------------------
00481071   1/1  ----------------------------------------------------------------------
00445261   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00423661   1/1  ----------------------------------------------------------------------
00461141   1/1  ----------------------------------------------------------------------
00530191   1/1  ----------------------------------------------------------------------
00486731   1/1  ----------------------------------------------------------------------
00502041   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00512641   1/1  ----------------------------------------------------------------------
00462531   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00487991   1/1  ----------------------------------------------------------------------
00474811   1/1  ----------------------------------------------------------------------
00508901   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00488631   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00367441   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00385671   1/1  ..........------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------
00487551   1/1  ----------------------------------------------------------------------
00456451   1/1  ----------------------------------------------------------------------