[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30379.1


[Show Plain Result]

## Summary of Sequence Search
   1::167
  19::163  8.5e-26 28.1% 0044195 00441951 1/1   like                                    
   1::167


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKIALSICVLVSAFTAAYADTKIAVVNPVEIFNDSDLGSVSVKKLENDLKPDATKLKQEQDNIMQQMKT
00441951   1/1  ------------------aaaakiavvdverilqespagkkalekleaefkklqkeleklekelqkl...


                         -         -         *         -         -         -         -:140
query           LQDNSATMTKSELDKKQQQIQQEQQNFAEKARILQQKEYTAKDKLSKKFQASFDKAVQTIAKQKNYNVVL
00441951   1/1  lekdaallseaereklekelekkvqefqkkaqelqedlekrqnellakllekilkaikkvakkegydlvL


                         +         -         -         -         -         *         -:210
query           TTQALAYVNNVDDISSQVVELMNKDSE-------------------------------------------
00441951   1/1  dknalvlyaddslDiTdeVlkal-----------------------------------------------