[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30394.1


[Show Plain Result]

## Summary of Sequence Search
   1::230
   1::151  5.6e-48 49.0% 0047579 00475791 1/1    III domain-like                        
   1::157  1.8e-45 49.0% 0041655 00416551 1/1    III domain-like                        
  29::142  9.8e-23 32.7% 0044214 00442141 1/1    III domain-like                        
 106::221  7.8e-21 40.2% 0050560 00505601 1/1   -binding domain-like                    
 146::232  2.9e-13 34.1% 0050801 00508011 1/1   -binding domain-like                    
 144::221  6.4e-13 39.5% 0052224 00522241 1/1   -binding domain-like                    
 147::228    1e-12 36.2% 0050561 00505611 1/1   -binding domain-like                    
 146::221  1.3e-12 37.0% 0037064 00370642 2/2   -binding domain-like                    
 147::221  1.6e-12 34.2% 0044374 00443741 1/1   -binding domain-like                    
 153::223  2.4e-12 40.6% 0036436 00364361 1/1   -binding domain-like                    
 140::231  3.8e-12 34.4% 0042985 00429851 1/1   -binding domain-like                    
 153::224  4.5e-12 35.7% 0043193 00431931 1/1   -binding domain-like                    
 146::225  2.1e-11 38.4% 0051934 00519341 1/1   -binding domain-like                    
 151::226  2.4e-11 38.4% 0052443 00524431 1/1   -binding domain-like                    
 153::221  3.1e-11 41.2% 0041656 00416561 1/1   -binding domain-like                    
 139::228  5.1e-11 31.0% 0042986 00429861 1/1   -binding domain-like                    
 141::231  5.2e-11 34.5% 0052472 00524721 1/1   -binding domain-like                    
 149::226  2.3e-10 36.6% 0051935 00519351 1/1   -binding domain-like                    
 144::231  2.6e-10 32.9% 0050799 00507991 1/1   -binding domain-like                    
 154::232  4.2e-10 34.2% 0050800 00508001 1/1   -binding domain-like                    
 148::221  6.5e-09 36.1% 0049541 00495411 1/1   -binding domain-like                    
 147::221  4.6e-07 35.6% 0049542 00495421 1/1   -binding domain-like                    
  11::66   1.1e+02 23.2% 0037064 00370641 1/2   -binding domain-like                    
   1::230


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFTDLAEGKLSQL
00475791   1/1  ldlllealekllgytfkdldllleALthssyanelnyerLefLGDavLdlvvseylflrfpdlsegeltk
00416551   1/1  vllraellallealekrlgykfkdlsllleAlthpsyanerltlqeglrlnnerLeflGDavlelvvsey
00442141   1/1  ----------------------------kdlkllnnerLeflGDavlelvvrlylllkgp.lkegdLhrl
00505601   1/1  ----------------------------------------------------------------------
00508011   1/1  ----------------------------------------------------------------------
00522241   1/1  ----------------------------------------------------------------------
00505611   1/1  ----------------------------------------------------------------------
00370642   2/2  ----------------------------------------------------------------------
00443741   1/1  ----------------------------------------------------------------------
00364361   1/1  ----------------------------------------------------------------------
00429851   1/1  ----------------------------------------------------------------------
00431931   1/1  ----------------------------------------------------------------------
00519341   1/1  ----------------------------------------------------------------------
00524431   1/1  ----------------------------------------------------------------------
00416561   1/1  ----------------------------------------------------------------------
00429861   1/1  ----------------------------------------------------------------------
00524721   1/1  ----------------------------------------------------------------------
00519351   1/1  ----------------------------------------------------------------------
00507991   1/1  ----------------------------------------------------------------------
00508001   1/1  ----------------------------------------------------------------------
00495411   1/1  ----------------------------------------------------------------------
00495421   1/1  ----------------------------------------------------------------------
00370641   1/2  ----------ieellgkdpkslLqelaqkrglppeYellsesgpahaklFtvevlvgglvftgtGs----


                         -         -         *         -         -         -         -:140
query           RSKLVKGTTLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPI
00475791   1/1  lrsalvsnetlaelarklglgkylllgkgel....rpkiladvfEAliGAiyldsgleavrkfllrlllp
00416551   1/1  lfkkypdlsegelsrlrsalvsnktlaklarelgldkylrlgrgekssgglkrpkiladvfEAliGalyl
00442141   1/1  raalVsakalaklllelllgelLteeeleivkrGrnaksltvpknadvatyrlatafEAllGylyldggl
00505601   1/1  -----------------------------------esiladalealigaiyldrgl..............
00508011   1/1  ----------------------------------------------------------------------
00522241   1/1  ----------------------------------------------------------------------
00505611   1/1  ----------------------------------------------------------------------
00370642   2/2  ----------------------------------------------------------------------
00443741   1/1  ----------------------------------------------------------------------
00364361   1/1  ----------------------------------------------------------------------
00429851   1/1  ---------------------------------------------------------------------p
00431931   1/1  ----------------------------------------------------------------------
00519341   1/1  ----------------------------------------------------------------------
00524431   1/1  ----------------------------------------------------------------------
00416561   1/1  ----------------------------------------------------------------------
00429861   1/1  --------------------------------------------------------------------ll
00524721   1/1  ----------------------------------------------------------------------
00519351   1/1  ----------------------------------------------------------------------
00507991   1/1  ----------------------------------------------------------------------
00508001   1/1  ----------------------------------------------------------------------
00495411   1/1  ----------------------------------------------------------------------
00495421   1/1  ----------------------------------------------------------------------
00370641   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ISSINLDTIKVKDSKSKLQEILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAE
00475791   1/1  lleellldlll-----------------------------------------------------------
00416551   1/1  dggleaarefllklllp-----------------------------------------------------
00442141   1/1  er--------------------------------------------------------------------
00505601   1/1  .......eppgknpkslLqelcqkrklplPvYelv...gpdhdkrFtvtVtvngqeyqasgegkskklAe
00508011   1/1  -----llnlllknpkslLqelaqkrglg.peYelveesgpdhaklFtvevvvggkvf.gegtGsskkeAe
00522241   1/1  ---elllllllkdpkslLqellqkrglplPeYelveesgpdhaklFtvevtvggl..lgegtgsskkeAe
00505611   1/1  ------lnplgknpkslLqelaqkrklp.peYelvee.gpdhaktFtvevrvgglvylgtgtgksKKeAe
00370642   2/2  -----ieellgkdpkslLqelaqkrglp.peYellsesgpahaklFtvevlvgglvf..tgtGsskkeAe
00443741   1/1  ------elllgknpkslLqelaqkrglplpeYellsesgpahdplFtvevsvggi..lgegsGsskkeAk
00364361   1/1  ------------dpkslLqelaqkrglplpeYellsesgpdhaklFtvevtvggl..lftgtgrskkeAe
00429851   1/1  llaelillllgkdpkslLqelaqkrgl.lpeYellsesgpahaplFtvevvvdglvf.gegtGssKKeAe
00431931   1/1  ------------dpkslLqelaqklglplpvYellsesgpahdklFtvevtvgg..llgtgtgsskkeAe
00519341   1/1  -----llllllkdpkslLqelaqk.....peyellsesgpdhaplFtvevtvgglvf..egtgsskkeAe
00524431   1/1  ----------gkdpkslLqelaqkrgl.lpeyelveesgpdhaplFtvevtvgglvf..tgegssKkeAe
00416561   1/1  ------------dpkslLqellqkrglplpeyelvsesgpahaplFtvevlvgglvl.gtgsgsskkeAe
00429861   1/1  llaellllllgkdpkslLqelaqkrglp.peYeliee.gpahnplFtvevsvgglvfg.tGtGsskkeAk
00524721   1/1  lllelllllllkdpkslLqelaqk.....peYellsesgpdhakvFtvevtvgglvf..egeGksKkeAk
00519351   1/1  --------llgknpkslLqelaqk.....pvyelveesgpdhaklFtvevvvgglvf..egtgssKkeAe
00507991   1/1  ---elllnllgknpkslLqelaqkrglplpvyelv..egpdhaklFtvevtvgglvf.gtgtgksKKeAk
00508001   1/1  -------------ykslLqelaqklklglpyyel..esgpdhaklFtvevtvgglvl.gegtGrsKkeAk
00495411   1/1  -------eeldkdpkslLqellqklgl.kpeYklveesgpahnklfvvevlvggq.vlgtGvGkskkeAe
00495421   1/1  ------leeldkdpkslLqellqklgl.kpeYklveesgpahnklfvvevlvggq.vlgtGvGkskkeAe
00370641   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QKTAEKMIEMLSQQGLHEKK--------------------------------------------------
00475791   1/1  ----------------------------------------------------------------------
00416551   1/1  ----------------------------------------------------------------------
00442141   1/1  ----------------------------------------------------------------------
00505601   1/1  qaAAlaaLral-----------------------------------------------------------
00508011   1/1  qaAAklalekLlglplleldld------------------------------------------------
00522241   1/1  qaAAkaalekL-----------------------------------------------------------
00505611   1/1  qnAAkaalekLlklglle----------------------------------------------------
00370642   2/2  qaAAelalelL-----------------------------------------------------------
00443741   1/1  qaAAeaaleal-----------------------------------------------------------
00364361   1/1  qaAAeaaleaLln---------------------------------------------------------
00429851   1/1  qaAAklalekllklglleepp-------------------------------------------------
00431931   1/1  qaAAkaaleaLlnl--------------------------------------------------------
00519341   1/1  qaAAklalekLlglg-------------------------------------------------------
00524431   1/1  qaAAklalkkLlklpl------------------------------------------------------
00416561   1/1  qaAAkaalekL-----------------------------------------------------------
00429861   1/1  qaAAklalekLlklsllp----------------------------------------------------
00524721   1/1  qaAAkaalekllllpllekpp-------------------------------------------------
00519351   1/1  qaAAklalekllklsl------------------------------------------------------
00507991   1/1  qaAAkaalekLlkllllelsd-------------------------------------------------
00508001   1/1  qaAAkealkkLlklllleallv------------------------------------------------
00495411   1/1  qrAAeaaLenl-----------------------------------------------------------
00495421   1/1  qrAAeaaLenl-----------------------------------------------------------
00370641   1/2  ----------------------------------------------------------------------