[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30441.1


[Show Plain Result]

## Summary of Sequence Search
   1::334
   4::336  4.9e-84 37.2% 0046259 00462591 1/1   otidylyl transferase                    
   2::321  1.4e-78 38.5% 0049118 00491181 1/1   otidylyl transferase                    
   5::296  3.7e-63 38.5% 0039322 00393221 1/1   otidylyl transferase                    
   1::316  2.1e-61 31.3% 0047114 00471141 1/1   otidylyl transferase                    
   3::306  2.2e-60 33.8% 0053312 00533121 1/1   otidylyl transferase                    
   2::310    4e-59 31.9% 0048275 00482751 1/1   otidylyl transferase                    
   5::306  1.4e-37 28.3% 0039570 00395701 1/1   otidylyl transferase                    
   5::244  6.2e-36 27.8% 0039171 00391711 1/1   otidylyl transferase                    
   1::254  2.1e-13 22.4% 0052384 00523841 1/1   otidylyl transferase                    
   5::233  3.4e-10 22.6% 0038030 00380301 1/1   otidylyl transferase                    
   2::225  7.4e-09 21.7% 0048474 00484741 1/1   otidylyl transferase                    
   4::250  1.1e-08 19.6% 0047412 00474121 1/1   otidylyl transferase                    
   4::253  6.3e-07 22.8% 0037568 00375681 1/1   otidylyl transferase                    
   5::253  1.2e-06 21.4% 0040507 00405071 1/1   otidylyl transferase                    
  11::232  5.5e-06 19.8% 0038263 00382631 1/1   otidylyl transferase                    
   4::253   0.0003 20.8% 0039071 00390711 1/1   otidylyl transferase                    
   2::255  0.00056 22.8% 0043348 00433481 1/1   otidylyl transferase                    
   1::334


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSQKIILTGVTPSGTPHLGNYIGAIKPAIEMIKNDQYKCMYFIADQHSLIKLWDKKLRQQYIYEIAASWL
00462591   1/1  ---PlrvytGfdPTgslHlGhlvgalklrrllq..aghevilliaDldalrvlldpeeirenileiiaql
00491181   1/1  -ellvtPweveglsdegvdydklieefgielideellerlelltleellellrRglvfevtdedellell
00393221   1/1  ----kenlelierglielwreeelfellekkkvrvytgpdPtgslHlGhlrgaikldvlara..gydvlf
00471141   1/1  gmsvdellelllrglyntltdekelfklleggpvrvycGidPTgdslHlGhlvtadvlrrflra..gydv
00533121   1/1  --vdlllelllrglietltdeeelfkllekgpvrvycGidPTgdslHlGhlr.aldvlrylqd.agydvi
00482751   1/1  -gmslllklllirgllneltdekelfellegkpvrvycGptPtgplHlGhartalvlarflr..aGydvl
00395701   1/1  ----tvelllelierglieqltdeelldkllngkpvrlytgfdPtagslHlGhlvpldklrrfqra..gh
00391711   1/1  ----ynpleieeeilkklkkkkvvvvrtgpyPtGplHiGhargallgdvlarylrml.GydvlfvlgidD
00523841   1/1  gkkkflitvpppyvngplHlGhartyilaDvlaRylrmlGydvlfvpgtddhGlpielraeklgid....
00380301   1/1  ----ialpgfinlflieekllklweeeklfefllegkkkfvvtvppPypnGplHiGHarsailgDvlaRy
00484741   1/1  -tkvvvrfaPnPtGplHiGharsaligdllarylrGydv.lridDtD......perlteeyidailedlk
00474121   1/1  ---fppgkgkkvvversspnptgplHiGHarsavig..dalaRllralGydVlrvngvddaGtqigllaa
00375681   1/1  ---lalyntlnlpleefplrynlkeieekwqkyweekklfeallpllggkkkfyvtdppPypnGplHiGH
00405071   1/1  ----vtvpgpyvngllHiGHarsyilgDvlaRylrmlGydVlfvpgiddhGlpiella............
00382631   1/1  ----------sPtGyLHiGharnallndllarylr.GyfvlriedtD......pereteeyidailedlk
00390711   1/1  ---etalpkfynllliekkwqkfweekklfeaflpldpgkkkfyvttppPypnGllHiGHarnyvlaDvl
00433481   1/1  -kkkflvtvpppyvngllHlGHarnayilaDvlaRylrmrGydVlfvpgtDdhGlpielkaek.......


                         -         -         *         -         -         -         -:140
query           ALGLDPDKAYFYRQSDIPEIMELTWIISTTTAKGLLNRAHAYKALVDQNLQEENADPDKGITMGLFNYPV
00462591   1/1  lalgldpdktvifnqsdwleylellwdlgklttvgrllrkdsvk.........drlelgdpislgeftYp
00491181   1/1  eegkplrvytGfdPTgdslHlGhlvgalklrrll.qalgheviiliaDlhaligdpldleeirenieeli
00393221   1/1  ligDlhgliidpapkelvrenieeikeqllalgldpekwtifrqsdwgeyiellldlgklttvgellrrd
00471141   1/1  illigDltgliddpigkratrvgldpeelrenaieailedlkalgidpgkayifnnsdylpvlsfldylr
00533121   1/1  lliadltdliddkilkraerlgenlldpeelaenieeyaadllalgldpekvtiflnsdvlshleladll
00482751   1/1  fligDahgliidpagelglprelveenaaailedlkalgidpdkfiitaqseileiveliekLlekglay
00395701   1/1  evlvliGdatgrigDpdgkiieralltlelvdeni.eyikkllakgldydgpekvtivnnsdwlsklnli
00391711   1/1  tglpievkaeeegileeylgkpltgipdflgdprelaeeyideikedlkalgidpdwvsesslyksglyk
00523841   1/1  ...........preladeyiaeikedlkrlgisfdw..fyrttdpeyieavqeiflkLlekGliyrgegp
00380301   1/1  lrmlGydVlfvpgwDdhGlpiellaeklgiklllriddlgreeflelprelaeeyideikedlkrlgisf
00484741   1/1  algidwdeevrtqserldayqelfekllekGlayvcelsveflvelnlfyygrlsngevpeleavlrllv
00474121   1/1  slllrgleepedlypieylldlyvklkklaedeeleeeagefllrledgd.....pkrladesieeiked
00375681   1/1  arnyil.aDvlaRylrmrGydVlfvpgwDdhGlpielraekl....gktpedlgreeflelcrelaeeyi
00405071   1/1  .....eefgelpreladeyieefkedlkrlgisfdwfrptatlyieavqel........flkllekglay
00382631   1/1  wlglswdwsryyqserfdyy........qelflkLlekGlayrcfctvewlpalrtalaeagvepkyrgr
00390711   1/1  aRylrmrGydVlfvpgwDdhGlpielaaeklldiddkiprkelgreefgetp..relaeeyiaeikedlk
00433481   1/1  ................fgetpreladeyidefkedlkrlgisfdw..fyrttdpeyieavqeiflklyek


                         +         -         -         -         -         *         -:210
query           LMAADILIFDADLVPVGKDQIQHIEIARDIANRFNHIYQKPVLKAPQALTSEDSQTILGLDGRKMSKSYD
00462591   1/1  llqaaDilllgadlvpgGeDQlphielgrdlarrlgalykpp.fvlhlplltgllarllgldgpvkKMSK
00491181   1/1  aqllalgldpdktfivnnsdwlg..klswylsflldlgrlfrvnqmke.........rfglekgislgef
00393221   1/1  dvkdr...........wdssisfgllgYpllqaadilllgvdivpgGkDqwphhelgreiarpfpvllth
00471141   1/1  lsglvsvnrllrgddvkdrl.........ekdlpisfglftYpllqaadilhlgadivlgGkDqfphhel
00533121   1/1  rglarvgtlnrmldpkdfvlrk........adgiseglftypllqaaDilhlylgegadivpgGsDqlph
00482751   1/1  ealnrmvyfddvvdvwfdg........wsiglf.ypllqaadilllgadivlgGkDqffhlelgralara
00395701   1/1  dflrdlgkhvsvnrmlarddfalrl........edgislgeflYpllqayDflhlecgygvdlqigGsDq
00391711   1/1  eiitrqseyieliq..eilekllekglayekdgtvnflprcktalgdlsvevkkwgdgiplykakdiadv
00523841   1/1  vyycpscetaladlevedpvcwrsgapvevrlteqwflklsklkdkllekldpldfalwpesvkgellnw
00380301   1/1  dwfrpyattdpeyieavqevflkllekGliyrgerpvyydpscetaladaevepvcwrsgtpvevrlteq
00484741   1/1  dlgklvprdlvlgalwidlpgdeddwvivwgdglpgYdlavvvddallgidivvrGkDllfphalyeall
00474121   1/1  lkrLgvdfd..ryvresesyysgavqeviekLlekGlayekellvndgavlfrlekfgddgeledrvllk
00375681   1/1  deikedlkrlgisfdwdrfyaTtdpeyieavqelflkLyekGliyrgdgpvyycpscetaladrevegyp
00405071   1/1  egdgavyydplekegdlgdlelikldgpvcyrsgdpvelkltpqwfvllkglkdwaisRqrpwGvpiPgw
00382631   1/1  srelnlelviattrpetlegdyalrlkidlesglenlrDwvisrqrywghdipllrsdglptyflavvvd
00390711   1/1  rlgisfdwsrfyrTtdpeyieavqelflkllekgliyrgegpvnydpsdetaladaeveggeypvcwrsg
00433481   1/1  gliyrgegpvnycpscetaladaecwrsgtpvevrlteqwflklgklkdrllealeklew.pesvknrll


                         -         -         -         +         -         -         -:280
query           NTIAIFSMEKKLRKQVMKIITNSQMPEEKKDPNNCTIFAIYKSIASQTEIAALEEKYLAGGLGWGDAKQI
00462591   1/1  Slgnflsaifllddpeeirkkilkaytdpleliqfdlngdpeverllklltfl.dleeieeleady..gg
00491181   1/1  sYpllqaaDilhlelsallkadgdlldlvpgGsDQrphielgrdlarrln.......lpepyilttp...
00393221   1/1  pl..............llgldGveKMSKSkgnvitlddlleeiakkikkaftdprevygadalryfllsg
00471141   1/1  gralaralggkpp.yvlhhp.........lllgldGteKMSKSlgnaitlddllekigpkilryydalls
00533121   1/1  heleralaralgkkfpvywlhlp.........lltgldGeKMSKSlgnaitldd.ektipekirkallss
00482751   1/1  lglpfpevlthpl..........llgldGeKMSKSlgnsvitlldlleeygadilryfllsgnyrdddvl
00395701   1/1  fpnillgrdllrallgl.......pkpvglt...tplllgldGeKMSKSlgnaiwlddllksiykkiqka
00391711   1/1  wfdspwgygrpgyplecaaddlllgvdivlgGkD------------------------------------
00523841   1/1  lenglrdwcisRqswdrywGvpiPgwetdvldvWfdsslmylay--------------------------
00380301   1/1  wflklgkladrllealeegervi-----------------------------------------------
00484741   1/1  ealgl..........-------------------------------------------------------
00474121   1/1  sdGtptyllrDlaisrqrfwghpipgwespwgdvlptwfi------------------------------
00375681   1/1  vcwrsgapvevrlteqwflklsklddrllkalkkgefvpeevk---------------------------
00405071   1/1  hidvldvwfdslglpvdihvgGkDliffhllyeiailealfg.---------------------------
00382631   1/1  dallgithvlrGaDhlfntlry------------------------------------------------
00390711   1/1  tpvevrlteqwflklgkladrllealesgewippevvrkrlln---------------------------
00433481   1/1  nwlenglrdwciSRqrywGvpipvwiekddgkviyvwfdalvgyp-------------------------


                         -         *         -         -         -         -         +:350
query           LFEKINEYLRDAREKYDYYINNPKIVDDILNQGAAKVRPLAKDKLKEVKDIIGM----------------
00462591   1/1  lgpgdlKkalaeeltellhpirearaaleedk.llleilaegalkarelaektlee--------------
00491181   1/1  lltgldgpteKMSKSlgnsaIfllddpeeikkkilkfaftd-----------------------------
00393221   1/1  lpdkdvvfllelltel------------------------------------------------------
00471141   1/1  thyrlpldfsleellelldlllrlknarlaqlrlay----------------------------------
00533121   1/1  g......drdvlnllkll.lflalee--------------------------------------------
00482751   1/1  dfselilflaldllnklrnalrfgplllea----------------------------------------
00395701   1/1  ln........vydadvlrylllftfl--------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00484741   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00375681   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00382631   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------