[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30480.1


[Show Plain Result]

## Summary of Sequence Search
   1::121
   1::80   1.4e-18 33.8% 0049777 00497771 1/1   ed helix" DNA-binding domain            
   1::101  9.1e-18 29.7% 0049944 00499441 1/1   ed helix" DNA-binding domain            
   1::91   1.8e-16 31.9% 0043095 00430951 1/1   ed helix" DNA-binding domain            
   2::79   2.4e-16 30.8% 0053261 00532611 1/1   ed helix" DNA-binding domain            
   2::89   1.7e-15 32.9% 0043669 00436691 1/1   ed helix" DNA-binding domain            
   1::76   2.8e-15 33.8% 0051170 00511701 1/1   ed helix" DNA-binding domain            
   1::89   8.7e-14 31.5% 0044258 00442581 1/1   ed helix" DNA-binding domain            
   8::89   1.1e-11 34.1% 0052364 00523641 1/1   ed helix" DNA-binding domain            
   1::91   9.4e-11 30.8% 0049384 00493841 1/1   ed helix" DNA-binding domain            
  18::79   4.6e-09 30.6% 0053027 00530271 1/1   ed helix" DNA-binding domain            
  15::84   5.7e-08 24.3% 0048703 00487031 1/1   ed helix" DNA-binding domain            
  15::86   3.6e-07 20.8% 0043935 00439351 1/1   ed helix" DNA-binding domain            
  15::121  7.9e-07 24.5% 0040266 00402661 1/1   ed helix" DNA-binding domain            
  15::89     8e-07 24.0% 0041905 00419051 1/1   ed helix" DNA-binding domain            
   6::91   1.3e-06 25.6% 0051444 00514441 1/1   ed helix" DNA-binding domain            
  15::105  1.7e-06 25.3% 0043164 00431641 1/1   ed helix" DNA-binding domain            
  12::73   2.3e-06 27.4% 0045968 00459681 1/1   ed helix" DNA-binding domain            
   6::71   6.7e-06 25.8% 0052579 00525791 1/1   ed helix" DNA-binding domain            
   5::90   8.6e-06 22.1% 0051521 00515211 1/1   ed helix" DNA-binding domain            
  10::88   1.9e-05 20.3% 0051024 00510241 1/1   ed helix" DNA-binding domain            
  15::113  4.4e-05 24.5% 0052644 00526441 1/1   ed helix" DNA-binding domain            
   3::90     9e-05 20.2% 0048742 00487421 1/1   domain-like                             
   7::94   0.00012 20.5% 0052506 00525061 1/1   ed helix" DNA-binding domain            
  15::90   0.00014 22.4% 0042156 00421561 1/1   ed helix" DNA-binding domain            
  15::118  0.00049 21.6% 0040517 00405171 1/1   ed helix" DNA-binding domain            
   5::88    0.0008 20.2% 0052755 00527551 1/1   ed helix" DNA-binding domain            
   1::121


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLANIVDFQKALGDETRIRILMVIYQHQLCLCHLAHIFKLANSTLSKHLDILRRNGFIHKRKQGRFHYF
00497771   1/1  llllllllllllldeedleelaellkaLadptRlrIlrlLaeegeltvgeLaellglsqstvshhLkvLe
00499441   1/1  mldemleelaelfkaLadptRlrILelLaegeltvseLaellglsqstvsrHLkkLeeaGlverrregrd
00430951   1/1  dellleelaellkaladptrlrilrlLaegelsvgelaealglsqstvsrhLkvLeeaglvkrrregrrv
00532611   1/1  -mmedlarllkaLgdptrlrILrlLlegpltvseLaeelgisqstvsrhLkkLeeaGlverrrepedrgg
00436691   1/1  -mllllllelleelaellkaladptrlrilrlLaegelsvgeLaealglsqstvsrhLkvLeeaglverr
00511701   1/1  lllllllllllllleelleelarllkaladptRlrILrlLa.gelsvselaellglsqstvshhLkvL.e
00442581   1/1  mdrlllalllkalldptrlliLllLaedgeltvseLaellglspstlsrhLkrLeeaGlverrrdpedgr
00523641   1/1  -------raaraliellaellkalgldptrlriLllLlengepltvseLaellglskstvsrhlkkLeea
00493841   1/1  llrllleelaellkalgldptrlriLllLlenggltvseLaeelglsrstvsrrlkrLeeaGlvererap
00530271   1/1  -----------------rarilllLlegplsvaeLaealglsqstvsnhLkvLrdaGlvvaekegrrvly
00487031   1/1  --------------llkllklseleleilrlLwklgpltvkeiaeeleeelglspstvstlLkrLeekgl
00439351   1/1  --------------glgltplqlliLllLaegpgltvyelaerlggllslspgtvyrllkrLekeGlver
00402661   1/1  --------------iflllraarllikllgellkrlglsptrlriLalLaesdgpltvselaeelglsks
00419051   1/1  --------------kelgltplelevllvLwekgpltvkelaeelgeeldlspstvttllkrLekkGlve
00514441   1/1  -----lmllldlllllcpvaraldllgdkwrlliLrllldgplrfseLarrlpgisqstlsrrLkrLeed
00431641   1/1  --------------srtrlliLllLlealegelsftelaealglsqstvsrhlkkLeelglver..egk.
00459681   1/1  -----------lllderrlkillllledgrlsveeLaeelgvSrstvrrhlkrLeeaGliiesvpgkgyr
00525791   1/1  -----varaldllgdkwrlliLrlllegplrfgeLarrlgiskstLsrrLkrLeeaGlvervypedprrv
00515211   1/1  ----pvalaldllgdkwrlliLrlllegplrfseLarllpgisqgtltrrLkrLeedGlverevypedpr
00510241   1/1  ---------kelllgllqlliLalLaegplygyelaklleellggllgisegtlypaLkrLekkglvery
00526441   1/1  --------------lslsleslllldlldlllldlldmedpdldelelellfllrrlaralrrlldellk
00487421   1/1  --llrvnqlgglfvmgrplsvelRlkivllaaeG.lspreiarrlgvsrstvskwlkryretGsvglkpr
00525061   1/1  ------rivlelllgklrlliLalLaegplhgyeLakrleelslgllpgispgtlypaLkrLeedGlver
00421561   1/1  --------------tltqlliLllLaeaeeggltvkelaeklglskstvtrllkrLekkglvervrspeD
00405171   1/1  --------------tltqfrvLllLaenggltvseLaerlglsrstvtrllkrLeekGlvererdpedrR
00527551   1/1  ----pvalaldllggkwklliLrlllngplrfseLaralpgisqktlsrrLkeLeedglverrvypedpp


                         -         -         *         -         -         -         -:140
query           YFNSAYQQQLNWLFDILADDEIIQSDQKLVKQLIAQELEHLPEIHAKENIL-------------------
00497771   1/1  eaGlverrre------------------------------------------------------------
00499441   1/1  rgrpekyYrltdeglallpdlleellvdlle---------------------------------------
00430951   1/1  yyrltdeglaellelllelle-------------------------------------------------
00532611   1/1  rrvyYrlte-------------------------------------------------------------
00436691   1/1  rdgrrvyyrltdeg...la---------------------------------------------------
00511701   1/1  aglver----------------------------------------------------------------
00442581   1/1  rvyysltekgrellealle---------------------------------------------------
00523641   1/1  Glverrrsegdgrkvyysl---------------------------------------------------
00493841   1/1  ldgrkvgysltekgelleell-------------------------------------------------
00530271   1/1  eltdsllas-------------------------------------------------------------
00487031   1/1  verekegrayiYsa--------------------------------------------------------
00439351   1/1  rrdrrrkyyslTekGk------------------------------------------------------
00402661   1/1  tvsralkrLeelGlvrrerspgdrrrvyysltekglillflerlrellekl-------------------
00419051   1/1  rekdgrrvvyysltekgee---------------------------------------------------
00514441   1/1  GlverrvypedprrveysLTe-------------------------------------------------
00431641   1/1  .yysLTekGeellellrellelleellelllelle-----------------------------------
00459681   1/1  lll-------------------------------------------------------------------
00525791   1/1  e---------------------------------------------------------------------
00515211   1/1  rveysLTekGrallpvllal--------------------------------------------------
00510241   1/1  leesegdrrrkyyrlTek----------------------------------------------------
00526441   1/1  elgltpaqfrvLlaLaenggggyltvseLaerlglskstvsrl---------------------------
00487421   1/1  gg...grprkltpeqveril--------------------------------------------------
00525061   1/1  evepsdgprrkyYrlTeaGrelle----------------------------------------------
00421561   1/1  rRvvllsLTekgrelleell--------------------------------------------------
00405171   1/1  avllsLTekGrelleellelheelleelleglseeeleallrll..ek----------------------
00527551   1/1  rveYsLTelGrellpvll----------------------------------------------------