[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30541.1


[Show Plain Result]

## Summary of Sequence Search
   1::351
  30::227  3.5e-26 27.1% 0038932 00389321 1/1   inic receptor ligand binding domain-lik 
 227::351  0.00016 21.8% 0041810 00418101 1/1   transmitter-gated ion-channel transmemb 
 227::351  0.00035 23.4% 0041811 00418111 1/1   transmitter-gated ion-channel transmemb 
   1::351


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRNIYKIILVLSIVAIFYSDIFGYGDIPPQKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLE
00389321   1/1  -----------------------------gepvnVtvsltllsiisvdevnqeltvdvwlrqsWtDerla
00418101   1/1  ----------------------------------------------------------------------
00418111   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FDKNEEKTPYKLYQGDFQYDEVFEGWKPQISIINEIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRL
00389321   1/1  wnpseyglilrlpldki........WlPdiflynskdadfhltntlvrvysdGtvlylpplivkssCpld
00418101   1/1  ----------------------------------------------------------------------
00418111   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGK
00389321   1/1  l.lFPfDvqtCslkfgswtydgeevdllwllle......pvdlsdfielgewelldltatret..llysc
00418101   1/1  ----------------------------------------------------------------------
00418111   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PQRISMLEFSISLERKPTNILLKVLIPLTLLVLAMWAIFWMDTKALSDRLNIAFIGILSVIAYQFLIEGE
00389321   1/1  ctglyslltftltlrRk-----------------------------------------------------
00418101   1/1  ----------------plyYvinlyiPcilivilswvsFwlpada.gervsLgiTtLLtmtvflllvaes
00418111   1/1  ----------------plyYvinlyiPcvlivilswvsFwlpada.gervsLgittLLtltvflllvaes


                         -         *         -         -         -         -         +:350
query           MPDIDYLTFTDGFLLLSFSILFSTVLESLAVYWLIKLNKDKLARKMDIFSRFVFPISYLVLITSLYFIYL
00389321   1/1  ----------------------------------------------------------------------
00418101   1/1  lPktslyvPligvyllvcmvlvflslletvvvlylhkrsplthpmppwvrvlflkllprlllmrrpeesl
00418111   1/1  lPktslyvPligvYllvcmvfvflslletvvvlnlhhrgplthkmppwvrvlflellprlllmrrpgell


                         -         -         -         -         *         -         -:420
query           H---------------------------------------------------------------------
00389321   1/1  ----------------------------------------------------------------------
00418101   1/1  r---------------------------------------------------------------------
00418111   1/1  l---------------------------------------------------------------------