[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30570.1


[Show Plain Result]

## Summary of Sequence Search
   1::640
 143::534  1.4e-99 29.8% 0048117 00481171 1/1   s)glycosidases                          
  89::528  4.2e-98 34.3% 0038123 00381231 1/1   s)glycosidases                          
 160::532  3.5e-97 34.5% 0039218 00392181 1/1   s)glycosidases                          
 136::533  1.7e-94 31.9% 0045947 00459471 1/1   s)glycosidases                          
 122::537    3e-89 30.9% 0046924 00469241 1/1   s)glycosidases                          
 156::555    4e-89 28.6% 0044469 00444691 1/1   s)glycosidases                          
 156::530  1.1e-86 26.7% 0047491 00474911 1/1   s)glycosidases                          
 132::531  1.5e-84 28.3% 0047591 00475911 1/1   s)glycosidases                          
 147::530  1.5e-81 29.7% 0047117 00471171 1/1   s)glycosidases                          
 144::528  2.1e-81 27.9% 0042224 00422241 1/1   s)glycosidases                          
 160::547    9e-81 31.0% 0046336 00463361 1/1   s)glycosidases                          
 136::539  1.9e-80 29.3% 0051975 00519751 1/1   s)glycosidases                          
 148::527  1.2e-79 27.0% 0051481 00514811 1/1   s)glycosidases                          
 148::529  2.9e-79 29.2% 0046559 00465591 1/1   s)glycosidases                          
 144::530  7.6e-79 26.4% 0046152 00461521 1/1   s)glycosidases                          
 134::530  6.9e-78 29.3% 0048959 00489591 1/1   s)glycosidases                          
 147::530  3.9e-77 27.9% 0049424 00494241 1/1   s)glycosidases                          
 149::530    4e-77 27.5% 0046505 00465051 1/1   s)glycosidases                          
 147::530    7e-77 30.6% 0036198 00361981 1/1   s)glycosidases                          
 144::530  7.4e-77 26.1% 0046139 00461391 1/1   s)glycosidases                          
 154::530  1.7e-76 27.5% 0050760 00507601 1/1   s)glycosidases                          
 156::533  9.1e-76 28.6% 0046266 00462661 1/1   s)glycosidases                          
 156::528  9.6e-76 25.8% 0040789 00407891 1/1   s)glycosidases                          
 158::530  7.7e-74 26.9% 0040700 00407001 1/1   s)glycosidases                          
 156::530  1.3e-72 26.2% 0046023 00460231 1/1   s)glycosidases                          
 153::561  3.9e-72 28.9% 0048242 00482421 1/1   s)glycosidases                          
 149::540  4.6e-72 29.0% 0052962 00529621 1/1   s)glycosidases                          
 161::532  5.7e-72 29.4% 0047545 00475451 1/1   s)glycosidases                          
 157::508  1.6e-70 30.0% 0047246 00472461 1/1   s)glycosidases                          
 151::534  1.8e-70 28.5% 0051733 00517331 1/1   s)glycosidases                          
 156::510  2.6e-70 27.4% 0052913 00529131 1/1   s)glycosidases                          
 162::530  5.4e-66 28.0% 0046948 00469481 1/1   s)glycosidases                          
 153::527  1.1e-65 26.6% 0049836 00498361 1/1   s)glycosidases                          
 160::499  1.7e-65 29.8% 0045828 00458281 1/1   s)glycosidases                          
 160::503  9.9e-65 28.3% 0047236 00472361 1/1   s)glycosidases                          
 160::524  3.4e-63 26.0% 0046455 00464551 1/1   s)glycosidases                          
 154::599    2e-62 29.7% 0049124 00491241 1/1   s)glycosidases                          
 160::527  3.3e-59 28.3% 0052376 00523761 1/1   s)glycosidases                          
 160::524  3.8e-59 27.0% 0048530 00485301 1/1   s)glycosidases                          
 177::505  1.7e-52 26.6% 0046963 00469631 1/1   s)glycosidases                          
 159::485  4.3e-50 24.1% 0044281 00442811 1/1   s)glycosidases                          
 158::485  3.4e-38 23.5% 0052585 00525851 1/1   s)glycosidases                          
 535::641  1.4e-34 43.4% 0040842 00408421 1/1   syl hydrolase domain                    
 161::534  1.3e-27 22.6% 0050004 00500041 1/1   s)glycosidases                          
  26::137  2.3e-27 39.1% 0048116 00481161 1/1    domains                                
  23::132  3.9e-22 39.4% 0051973 00519731 1/1    domains                                
 183::556  2.6e-21 19.9% 0046122 00461221 1/1   s)glycosidases                          
 180::453  3.1e-20 21.5% 0051737 00517371 1/1   s)glycosidases                          
  33::137  6.7e-18 37.8% 0046558 00465581 1/1    domains                                
 175::521  7.4e-09 18.2% 0049162 00491621 1/1   s)glycosidases                          
  28::145    2e-08 20.9% 0045945 00459451 1/1    domains                                
 187::253  2.7e-06 25.8% 0046229 00462291 1/1   s)glycosidases                          
 537::640  4.2e-05 18.3% 0046022 00460221 1/1   syl hydrolase domain                    
   1::640


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKNKNSEQNTHSTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSICVIGDFNYWQV
00481171   1/1  ----------------------------------------------------------------------
00381231   1/1  ----------------------------------------------------------------------
00392181   1/1  ----------------------------------------------------------------------
00459471   1/1  ----------------------------------------------------------------------
00469241   1/1  ----------------------------------------------------------------------
00444691   1/1  ----------------------------------------------------------------------
00474911   1/1  ----------------------------------------------------------------------
00475911   1/1  ----------------------------------------------------------------------
00471171   1/1  ----------------------------------------------------------------------
00422241   1/1  ----------------------------------------------------------------------
00463361   1/1  ----------------------------------------------------------------------
00519751   1/1  ----------------------------------------------------------------------
00514811   1/1  ----------------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------
00461521   1/1  ----------------------------------------------------------------------
00489591   1/1  ----------------------------------------------------------------------
00494241   1/1  ----------------------------------------------------------------------
00465051   1/1  ----------------------------------------------------------------------
00361981   1/1  ----------------------------------------------------------------------
00461391   1/1  ----------------------------------------------------------------------
00507601   1/1  ----------------------------------------------------------------------
00462661   1/1  ----------------------------------------------------------------------
00407891   1/1  ----------------------------------------------------------------------
00407001   1/1  ----------------------------------------------------------------------
00460231   1/1  ----------------------------------------------------------------------
00482421   1/1  ----------------------------------------------------------------------
00529621   1/1  ----------------------------------------------------------------------
00475451   1/1  ----------------------------------------------------------------------
00472461   1/1  ----------------------------------------------------------------------
00517331   1/1  ----------------------------------------------------------------------
00529131   1/1  ----------------------------------------------------------------------
00469481   1/1  ----------------------------------------------------------------------
00498361   1/1  ----------------------------------------------------------------------
00458281   1/1  ----------------------------------------------------------------------
00472361   1/1  ----------------------------------------------------------------------
00464551   1/1  ----------------------------------------------------------------------
00491241   1/1  ----------------------------------------------------------------------
00523761   1/1  ----------------------------------------------------------------------
00485301   1/1  ----------------------------------------------------------------------
00469631   1/1  ----------------------------------------------------------------------
00442811   1/1  ----------------------------------------------------------------------
00525851   1/1  ----------------------------------------------------------------------
00408421   1/1  ----------------------------------------------------------------------
00500041   1/1  ----------------------------------------------------------------------
00481161   1/1  -------------------------ehadpyevLGahllgldgvggvvfrvwaPnAesVslvgdfnnwdg
00519731   1/1  ----------------------legrhhdpfavLGahl..lggvggvvfrvwaPnaerVsvvldgnew..
00461221   1/1  ----------------------------------------------------------------------
00517371   1/1  ----------------------------------------------------------------------
00465581   1/1  --------------------------------vLGahllg....dgvrfrvwaPnaesVslvl.fngw..
00491621   1/1  ----------------------------------------------------------------------
00459451   1/1  ---------------------------pgspypLGatyladgg..gvnFavfsptAtrVeLlLfdegdge
00462291   1/1  ----------------------------------------------------------------------
00460221   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNNYVYKSDPYAFFSELRPNTASIITTETQYTWS
00481171   1/1  ----------------------------------------------------------------------
00381231   1/1  ------------------ipllktggvwkveipg.ldggllykyrvygpyreldpktlsdpyalalyawg
00392181   1/1  ----------------------------------------------------------------------
00459471   1/1  -----------------------------------------------------------------dfdwg
00469241   1/1  ---------------------------------------------------kellekeleklleellael
00444691   1/1  ----------------------------------------------------------------------
00474911   1/1  ----------------------------------------------------------------------
00475911   1/1  -------------------------------------------------------------dldspldvk
00471171   1/1  ----------------------------------------------------------------------
00422241   1/1  ----------------------------------------------------------------------
00463361   1/1  ----------------------------------------------------------------------
00519751   1/1  -----------------------------------------------------------------tydwk
00514811   1/1  ----------------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------
00461521   1/1  ----------------------------------------------------------------------
00489591   1/1  ---------------------------------------------------------------pspewwk
00494241   1/1  ----------------------------------------------------------------------
00465051   1/1  ----------------------------------------------------------------------
00361981   1/1  ----------------------------------------------------------------------
00461391   1/1  ----------------------------------------------------------------------
00507601   1/1  ----------------------------------------------------------------------
00462661   1/1  ----------------------------------------------------------------------
00407891   1/1  ----------------------------------------------------------------------
00407001   1/1  ----------------------------------------------------------------------
00460231   1/1  ----------------------------------------------------------------------
00482421   1/1  ----------------------------------------------------------------------
00529621   1/1  ----------------------------------------------------------------------
00475451   1/1  ----------------------------------------------------------------------
00472461   1/1  ----------------------------------------------------------------------
00517331   1/1  ----------------------------------------------------------------------
00529131   1/1  ----------------------------------------------------------------------
00469481   1/1  ----------------------------------------------------------------------
00498361   1/1  ----------------------------------------------------------------------
00458281   1/1  ----------------------------------------------------------------------
00472361   1/1  ----------------------------------------------------------------------
00464551   1/1  ----------------------------------------------------------------------
00491241   1/1  ----------------------------------------------------------------------
00523761   1/1  ----------------------------------------------------------------------
00485301   1/1  ----------------------------------------------------------------------
00469631   1/1  ----------------------------------------------------------------------
00442811   1/1  ----------------------------------------------------------------------
00525851   1/1  ----------------------------------------------------------------------
00408421   1/1  ----------------------------------------------------------------------
00500041   1/1  ----------------------------------------------------------------------
00481161   1/1  ea.hpmerldeggvwelflpgllpgqlYkyrvdgpd.getllllDPyafalelgpldaslvvdpddy---
00519731   1/1  ....pmtrldd.gvfelflp.lgpgtrYkfrv...dg...llvaDPyafaqelgvldlslva--------
00461221   1/1  ----------------------------------------------------------------------
00517371   1/1  ----------------------------------------------------------------------
00465581   1/1  ..rlple.rddsgvwelfvpgllpgtlYkyrv.....ggtlllaDPyafalelgvhdaslvvdldhe---
00491621   1/1  ----------------------------------------------------------------------
00459451   1/1  leiallpltertg.gvWhvfvpelelenlgllpgqlYgYrvdGpydplsdkleelslaglladvdedGhr
00462291   1/1  ----------------------------------------------------------------------
00460221   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDELNETLPQYIKEMGYTHVEFMPLHEHPLDAS
00481171   1/1  --vvvdpdrldlpawwkdaviYeihvrsftndspgdgggdlaglaeklldylkdlGvtavwllPifespg
00381231   1/1  dlewllaraaldalapplsyvvvlpdpdwwkdaviYeihvrsftdgngdgdplgsldpllglflgGtlag
00392181   1/1  -------------------yiyefhdgdfd....ggGdlagiiekL.dyLkdlGvtaiwLsPifespggs
00459471   1/1  ddaplprwwk......daviYeihvrsftdgdgdivelgggdfagiiekL.dyLkdlGvtaiwLsPvfes
00469241   1/1  eaelekngelelllleleelllgllelllklygdplevrlrlallvllllgyvlldaawlairaptprww
00444691   1/1  ---------------pkplwwkdaviYeihvrsfadgngdgvgdlagiiekl.dyLkdlGvtaiwLsPif
00474911   1/1  ---------------gdlppppwwkdaviYeihvrsftdgdgdgdeelglllltgfdtivllfggdlagl
00475911   1/1  daviYqifpdrfangdpsndvvdpafdwgddrppliwwedavidsngdgiflrlfegdlaglaekLd.yl
00471171   1/1  ------lvlptpewwkdaviYeihvdsfadgdgdgvlllqlfewyapydlqllfggdlagiiekL.dyLk
00422241   1/1  ---lweddlppprwwkdaviYeihvrsfadgdgdgvhlfewylgdiarlqeylggdlagliekldleyLk
00463361   1/1  -------------------kviyelhprsftdlngdggdlaglaekldnylkdlGvtavwllPifespsd
00519751   1/1  ddaplprw......wkdaviYevhvrsftd....ggdlaglaekLd.ylkdlGvtavwllPifespgddn
00514811   1/1  -------llppplwwkdaviyqlfv.......G...dykgiaeklldyLkdlGvtaiwlsPvfespsgds
00465591   1/1  -------lddptplwwkdaviYeihvrsftdg....gdlagliekld.ylkdlGvtavwllPifespgdd
00461521   1/1  ---lweddlppppwwkdaviYeihpdsfadgdgdgdplnglllqgrevivhlfggdlagiidkalldyLk
00489591   1/1  daviYqifprrfadgdgdngiplrplliyelhvgsivhlfgG..dlaglaekld.ylkdlGvtavwllPi
00494241   1/1  ------ddlpppewwkdaviYeihvrsftdgdgdgvhlfqlfwgdialelqlflggdlagliekL.dylk
00465051   1/1  --------lppplwwkdaviYeihvrsftdgdgdgdlllgfewevgtdrllllfggdlaglaekld.ylk
00361981   1/1  ------dklpspawwkdaviYeihvrsfsdgdgdgvpllrlfegdltnlvllfggdlaglaekldlpyLk
00461391   1/1  ---lweddlppppwwkdaviYeihvrsfadgdgdgdplngllllgrevivhlfggdlagiidkllldyLk
00507601   1/1  -------------WwkdaviYeihprsftdgdgdgiplivhlfggdlagliekld.ylkdlGvtaiwlsP
00462661   1/1  ---------------aPllllpspewwkdaviYeihvrsfadgdgdgilllrllelglttivhlfgGdla
00407891   1/1  ---------------pkprwwkdaviYeihprsfadsdgdgiGdlagiiekL.dyLkdlGvtaiwlsPif
00407001   1/1  -----------------aviYeihvrsftdgdgdgggdlaglaekl.dyLkdlGvtaiwlsPifesp..s
00460231   1/1  ---------------lkppppwwkdaviYeihvrsftdgdgdgdpalrglllltdtytlllrfggdlagl
00482421   1/1  ------------lalpwwpdsevhvrsftwdsngdggdlaglaekld.ylkdlGvtavwllPifespsgs
00529621   1/1  --------Aspd.wwkdaviYeihvrsfadgdgdgvpllrttilglfggdlaglaekld.ylkdlGvtav
00475451   1/1  --------------------qidpllsfldsngdglfggdlaglaekLdeylkdlGvtavwlsPifesps
00472461   1/1  ----------------daviYevhvrsfnwdsngdggdlaglaekld.ylkdlGvtavwlsPifespsdg
00517331   1/1  ----------lspawwkdaviYeihvrsfadgdgdgvlalrtlivhlfgGdlaglaekld.ylkdlGvta
00529131   1/1  ---------------sdaviyelfv..rdsngdg.gdlaglaekld.ylkdlGvtavwlsPifespgdds
00469481   1/1  ---------------------lPesildsfg...G...dlagiaeklldylkdlGvtavwllPifespsg
00498361   1/1  ------------ewwkdaviYelfv..........gdfagiiekld.ylkdlGvtaiwlsPifespsvds
00458281   1/1  -------------------qviyelf..vwdsngdgggdlagliekl.dylkdlGvtavwllPifesp..
00472361   1/1  -------------------daviYelhvrsf...pgdgggdlaglaekld.ylkdlGvtavwlsPifesp
00464551   1/1  -------------------iYevhvdrFadgnpdgggdlagiiekld.yLkdlGvtaiwlsPvfespggs
00491241   1/1  -------------w.engviyelfvdsf...pg..gtlkglaeklldylkdl.ftavwllPifessggsd
00523761   1/1  -------------------iYqvhvdsFadsngdgggdlkgiaekld.yLkdlGvtaiwlsPvfespgla
00485301   1/1  -------------------iYevhvdsFadsngdgggdlkgiiekld.yLkelGvtaiwlsPvfespgla
00469631   1/1  ------------------------------------drkplvplvdtviyevhvrlltrsfsdvelfggg
00442811   1/1  ------------------AviYqvlvdrFadgdgdgggdlkgiiekld.yLkdlGvtaiwlsPvyenspl
00525851   1/1  -----------------edvlkqytlltgkpplpprwalgiyqsw.rsfyd.....gdlegilekld.yl
00408421   1/1  ----------------------------------------------------------------------
00500041   1/1  --------------------egtvevdgggfvlnGkpvflrGvnihpgsflsgegaggdyegieedld.l
00481161   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00461221   1/1  ------------------------------------------ngaflrGvnlggwlgltgdvapghydre
00517371   1/1  ---------------------------------------pfwallpvtwry.yyggiplmailelpydv.
00465581   1/1  ----------------------------------------------------------------------
00491621   1/1  ----------------------------------aafvevdgrgfvlnGkpvflrGvnyggsgdvlgdhy
00459451   1/1  fnpnk-----------------------------------------------------------------
00462291   1/1  ----------------------------------------------dylaelgvdaiwllPlypsplrds
00460221   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           WGYQPTGFYSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAIN
00481171   1/1  ddnwgYdvvdyfavdpryGtlddlkalvdaahkrGikvilDvVpNHtsddhpwlsdfdgsafyedpdgev
00381231   1/1  liekLd.ylkdlGvtaiwLlPifespsddskganywGYditdyfavdpryasnpldpfGtpedfkaLvda
00392181   1/1  dhGYdvvdyyavdpryGtpedfkeLvdaaHarGikVilDvVpNHtsddhhnpwfqdglelgfdspyadyy
00459471   1/1  plvdndpwlldkglygswGYdpvdyfavdpryGtdpdplsrledfkeLvdaaHkrGikVilDvVyNHtsd
00469241   1/1  kdaviYekllGliihvdsfa......GdlkgliekLd.yLkdlGvtavwlsPifespggpsdwGYdpvdy
00444691   1/1  espl.sdhGYdvtdyyavdpryGtledfkaLvdaahkrGikvilDvVpNHtsddhpwfkeflsgrdspyr
00474911   1/1  iekl.dylkdlGvtaiwllPifesp..sdhGYdpvdyfavdpryGtledfkaLvdaahkrGikvilDvVp
00475911   1/1  kdkLGvtavwllPifespsd..wGYdpvdyfaidpryGtpedfkaLvdaahkelrGikalvilDvVpNHt
00471171   1/1  dlGvtaiwlsPifesplgdssyhGYdvtdyyaidpryGtledfkeLvdaaherGikvilDvVpNHtsadh
00422241   1/1  dlGvtavwlsPifesplvdrkllnvggpsdhGYdpvdyyaidpryGtledfkaLvdaaharGikvilDvV
00463361   1/1  dspglpwyhgYdpvdy.avdpryGtledfkaLvdaahkrGikvilDvVpNHtsadhpwfldvlevgssfd
00519751   1/1  wgYdvtdyfaidpryGtpedlkalvdaahkrGikvilDvVpNHt........spdgpwfkdhpdwyywrd
00514811   1/1  vglpwyhgYdpvdy.aidpryGteedfkeLvdaahkrGikVilDvVlNHtagdhpwfqdalsggdspyrd
00465591   1/1  nwgYdvtdyfavdpryGtpddlkalvdaahkrGikvilDvVpNHtsddhpwfkefpgwdyylwddp....
00461521   1/1  dlGvtaiwlsPifesplvnelgllnlggpsyhGYdptdyyaidpryGtledfkeLvdaaharGikvilDv
00489591   1/1  fespsddsdgglpwywgYdvvdyyaidpryGtpedlkaLvdaahkrGirvilDvVpNHtsadhpwfkdfl
00494241   1/1  dlGvtavwllPifesps..dhgYdpvdyfaidpryGtledlkaLvdaaherGikvilDvVpNHtsddhpw
00465051   1/1  dlGvtaiwllPifesps..dhgYdvvdyfavdpryGtledfkaLvdaaherGikvilDvVpNHtsddhpw
00361981   1/1  dlGvtavwlsPifesplgnrllgngslsdwgYdpvdyyaidpryGtledfkeLvdaahkrGikvilDvVp
00461391   1/1  dlGvtaiwlsPifesplvdrkllnvggpsdhGYdptdyyaidpryGtledfkeLvdaaharGikvilDvV
00507601   1/1  ifesp..sdhGYdvvdyyavdpryGtledfkaLvdaaharGikvilDvVpNHtsddhpwfkdflgsgdds
00462661   1/1  glaekLdlgylkdlGvtavwllPifespsdlrklgnkglpdswgYdpvdyyaidpryGtledfkaLvdaa
00407891   1/1  espg.sdhGYdvtdyyavdpryGtledfkeLvdaahkrGikvilDvVpNHtsddhpwflealsgrdspyp
00407001   1/1  dwGYdpvdyyaidpryGtledfkeLvdaahkrGikvilDvVpNHtsddhpwfkdaleggspyrdyyilyd
00460231   1/1  iekL.dylkdlGvtaiwllPifesp..sdhGYdvvdyyavdpryGtledfkaLvdaahkrGikvilDvVp
00482421   1/1  adwgYdpvdyyaigesygkgavdprlGtledlkalvdaahkrGikvilDvVpNHrtsadhpw.gpfpdwf
00529621   1/1  wllPifespsdtnlkgpadwgYdpvdyyaidpryGtledlkalvdaahkrGikvilDvVpNHtspdhpwf
00475451   1/1  ddsspwywgYdpvd.yaidpryGtledfkalvdaahkrGikvilDvVpNHtsddhpwfqdhplrgsdyrd
00472461   1/1  swGYdvtdyyapgsydqkgtvdprlGtledlkalvdaahkrGikvilDvVpNHtaesddhpwfqdvleng
00517331   1/1  vwllPifespsddslgglwyhgYdpvdyyavdprlGtledlkalvdaaherGikvilDvVpNHtspdspw
00529131   1/1  wgYdvtdyyapgsyyakglvdprlGtledlkalvdaahkrGikvilDvVpNHtagsddhpwfqdvlengd
00469481   1/1  dswyhgYdpvd.yaidpryGtledfkalvdaaherGikvilDvVpNHtsddhpwfldhldggdspyrdyy
00498361   1/1  lldvglpwywgYdpvdyyaidpryGtledfkeLvdaaherGikvilDvVlNHtaddhpwfkeadspypdy
00458281   1/1  sdhgYdvvdyyaidepryGtledlkalvdaahkrGikvilDvVpNHtsadhpwfkdvlesfdgsyndyyy
00472361   1/1  sd..hgYdpvdyyaidpsrfGtledlkalvdaaherGikvilDvVpNHtsadhpwfkdalepfdgtylfr
00464551   1/1  dhgYdpvdyyavgefyakgpvdpryGtledlkeLvdaaharGikvilDvVlNHtsdehpwfqeallrvld
00491241   1/1  wgYdptdyyaldprlGteedlkaL.....arGirvilDvVpNHtaadspwfldvlangrgleypdyfyiv
00523761   1/1  dhgYdpvdyyavgeflakgtvdpryGtledlkeLvdaaharGikvilDvVlNHtsgdhpwfqealvlvdl
00485301   1/1  dhgYdpvdyydlgefdqkgavdpryGtledlkeLvdaaharGikvilDvVlNHtsdehpwfqeallrvld
00469631   1/1  tlagliekld.yLkdlGvtavwlsPvfesalvgllsvgggayhgYdpvdyf.vdpryGteeelkalvdal
00442811   1/1  adhGYdvvdyydigefdqkgsvdpryGtledlkeLvdaahkrGikvilDvVpNHmtsddhpwfvdalssd
00525851   1/1  kelGipldaiwldpiwe......dgydvgdyt.vdperfg...dfkalvdelharGikvil.wvdnhtsp
00408421   1/1  ----------------------------------------------------------------------
00500041   1/1  lkelGfnavRlspiweriepdgggyigdyly.....pgtyneeglddldelvdaahkrGikvildlv.nh
00481161   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00461221   1/1  iteedldllkelGfnavRl.piswsriepsggdptydp.......gglddldelidaakkaGiyvildlh
00517371   1/1  vvydidyfdg....glgrf.ppelidelhekGlkviayld..vges...edsrpdwdglllldnpdwllk
00465581   1/1  ----------------------------------------------------------------------
00491621   1/1  dreiieedldllkelGfNavRlphgneiswsr......iep.gpgtyn..eeglddldelidladknGiy
00459451   1/1  ----------------------------------------------------------------------
00462291   1/1  .PYdissyfainplyidlgtledfdllleeahlrglklidydl---------------------------
00460221   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KGWGTHNFDLGRNEVKCFLISNAMYWINEFHIDGLRVDAVSNILYLNYDREDGQWIPNIYGGHENLEGIA
00481171   1/1  yyldffglpdlnyenpevreflldvlrywldeygvDGfRlDaakhllpddggrdfgelllnaiggdvlle
00381231   1/1  aHarGikVilDvVpNHtsddhpwfqehpewfyvladgsrssedspyrdwyiwrdldldllalilelvdlk
00392181   1/1  ywrdpdgglllplppnnwgswfggsawtydgdtgqyylhlflpggpdlnyenpgllevreflldvlryWl
00459471   1/1  dhpwfkeapedgpglsdfdgpyrdyyhwddgrgvpnnwlgglpdlnyenpevrdflldvlrywldeygvD
00469241   1/1  yavdpryGtledlkaLvdaahkrGikvilDvVpNHtsddspwfqdvlngrgsdypdyyhwrdddldavpp
00444691   1/1  dyyiwrdgfdgtppnnwlspflgsawdwddltgnyylhlfllglpdlnyenpevreelldvlrywl.eyg
00474911   1/1  NHtsddhpwfkeflgsgldsyrdyyfaadppdiwdeddgnyylhlflgglpdlnyenpevreylldvlry
00475911   1/1  sadhpwfkehpdwyifpgvpngyadffggsawengdgryylhtfwgdlpdlnyenllpevreflldlles
00471171   1/1  pwfkdaperdgyswydgnfpndwhsffggsawtndsgvgnyylhlfasglpdlnyenpevreflldvllf
00422241   1/1  pNHtsddhpwfldaldggslyrdyyifdgedpdpnnylsafgisawdddnevyyldlfglpdlntenpev
00463361   1/1  gfyrdyygwpdgdldppnnwisrlggsatgwgdltqvryldlfglpdlnyenpevreelldvllywl.ey
00519751   1/1  gflgdlpdlnyenpevreflldvlrywldeygvDGfRlDaak.hlyrdeplefleelrdav..revlpdv
00514811   1/1  yyifpdvgdgyspfnwgsyffdggdiwdyddatgvgnldlfglpdlntenpeVrdflldvlrywl.elgv
00465591   1/1  ...wgglpdllnyenpevreylldvlrywldeygvDGfRlDaakhllkdvpldflkelreavrnl.nvfl
00461521   1/1  VpNHtsddhpwfkeflgggldyyddyylgapnnwfslfggsawiwdeddgnyylhlflgglpdlnyenpe
00489591   1/1  esgdspyadyfvwvdpdgipnnwyrprdgilnyddfwgvyylhlfgtflldlpdlnyenpevreelldvl
00494241   1/1  fldvlfngpdspyadyyffdddwiydyedgnyvlhlflgdlpdlnyenpevreflldvllywldeygvdG
00465051   1/1  fldflfngldspypdyfhwrddgwlyddatgnyvlhlflgdlpdlnyenpevreflldvllywldeygvd
00361981   1/1  NHtsddhpwfldalergspypdyyvlrddggppnnftgigngsdwddatgvyyldlfglpdlntenpevr
00461391   1/1  pNHtaddhpwfkefpgggldyyddyylgapnnwlsyfggsawiwdyddgnyylhlflgglpdlnyenpev
00507601   1/1  yddyyfdadadlnwlsdfglsawiwdeddgnyvlhfflgglpdlnyenpevreelldvllywl.eygvDG
00462661   1/1  herGikvilDvVpNHtsadspwfldvldggspyedyylfpdvpldpsdfvlpgpitnwddvvnvrylhlf
00407891   1/1  dyyiwrdpgtdlppnnwlspfggsawgddedvgnyylhlfsgdlpdlnyenpevreelldvlrfwlde.g
00407001   1/1  ypdppndwhsyfggsawtayedgnyylhlfllglpdlntenpevreelldvllywl.elgvDGFRlDavk
00460231   1/1  NHtsddhpwfkdlleggddsyydyyfdadpdpltyddddgnyylhlflgglpdlnyenpevreylldvlr
00482421   1/1  vwgdgsyylapyppndwllfglsllldgsiwnydtftgvlnllnyenpevreelldvllywl.eygvdGf
00529621   1/1  pevpeglnpfddayyfhsedpgsdwsddtgvgnyylhlflldlpdlnyenpevreylldvllywldeygv
00475451   1/1  yyiwrdgdldfhppnsawdwddignvryldlfglpdlnyenpevreelldvlrywl.eygvdGfRlDaak
00472461   1/1  dnllvllspyadwfiwrdpkfdgsgvvlppnnwlsllfdgsalyefpdpgeyylhlgditdwgdfsgdev
00517331   1/1  fkehldwyvwfdgpgyfhsedpisdweddtgvgnyylhlfllglpdlnyenpevreelldvllywleeyg
00529131   1/1  dllvllspypdyfvwrdldypgvpggypdfnwlsvlfdgtdwgdyadvtgcyylhlfdldawgvavdnyr
00469481   1/1  ildfrsgflgsawgydndliqyylhflvdlpdlnyenpevreelldvllywl.eygvdGfRlDaakhl..
00498361   1/1  yhwrdppnnysddfgvgnwdllglpdlnyenpevreylldvlrywl.eygvdGFRlDaakhl........
00458281   1/1  dlnwfslfggitnwddltglyylntfllglpdlnyenpevreelldvllywleeygvdGfRlDaakhl.p
00472361   1/1  gppnnwyyflggitnyddgtgqyylntfllglpdlnyenpevreelldvllywleeygvdGfRlDaakhl
00464551   1/1  ngrdspyrdyyiiadgtgflfpgvpylysdfnllhllgditdyddappvnwisvfggsawewdedvgqyy
00491241   1/1  ddftlpgvpysdldlvvrprdgpllnysdffngihrvwgtflsdlpdlnyenpevreelidvllywl.el
00523761   1/1  ssrdspyrdyyiwrdgtgfdfpllgdlyssllgtllsfagldyllypgvppnnglfhfdgsawdyddgqy
00485301   1/1  nsrdspyrdyyiwadgglfdfpgvpllysdfllelllfsgvdglppnnwlsifggsgwiwdyndgqyylh
00469631   1/1  haaGikVilDvVpNHtagggpdgptllglglpnyfhyrgwitdydddnevgncdlgglpdlntenpeVrd
00442811   1/1  dnglllelspyrdyyiwtdfdfdgrldlysppnnwlsffggsawdldeltgnyylhlgditdygvgnevg
00525851   1/1  dspwflehldpdwfvwrpdggqyylhlwpgdqpdldftnpevreylldvlrfwl.eygvDgfrlDavep.
00408421   1/1  ----------------------------------------------------------------------
00500041   1/1  tdlpgdqgglpawlgdalyskdnpyrdwyvwrdgkpgg......wtnpevreafldyarylaeryadlrl
00481161   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00461221   1/1  wdppswlpddyggg.......lwtnpe.lleafadyaralaerykdhpnvigwelgNEpnggalenllay
00517371   1/1  rldgWpgsvwldytnpevreflldvlkfll.eyGfDGfflDgvdsylyp........andnydgypltre
00465581   1/1  ----------------------------------------------------------------------
00491621   1/1  vildlhpywtapghqdgppawlddyggigfrgallwsn.pefleafadyaralaerinpltglyykdhps
00459451   1/1  ----------------------------------------------------------------------
00462291   1/1  ----------------------------------------------------------------------
00460221   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           FLKELNGVLKHTCKGVITIAEESSSWPDISTPVEKGGLGFDFKWNMGWMNDTLRYISLDPVYRKYHHNLI
00481171   1/1  aheflkelrdavkalkpdvflvgEvwtgfpevlrpylrgglgfdsvfnfplygllllalkgglvdlltal
00381231   1/1  lsldyaelppnnwlsifggsawyllldldghglnyfdggnllefadgldgyhppwgdllfldllllfldl
00392181   1/1  dinyrrnfdllgladLrvedpeVrealhrllaeygvDGFRlDavkhllkppdflrelrdalpdvflvgEv
00459471   1/1  GFRfDaakhllkddllrdlpllgdlngyllpnvlgganlpeaheflrelreavdavlpdvfligEvwdgg
00469241   1/1  nnwdsvfrprdgsawdwdgtgnyvlhlflsglpdLnyenpeVreylldvllywl.eygvDGfRlDaa.kh
00444691   1/1  vDGfRlDavkhllkdlllldyplpegllypnklggldnpepheflrelreavrel.pdvfligEvwdgdp
00474911   1/1  wldeygvDGfRlDaakhlp........................heflrelreavrelypdvfligEvwdg
00475911   1/1  vllywldleygvdGfRlDaakhl.............pneggglenleaheflrelrdavrellpdvflia
00471171   1/1  wldeygvDGfRlDavkhl........................pveflkelreavrelgpdvflvgEvwdg
00422241   1/1  reflldvllywld.ygvDGFRlDavkhl........................ppeflrelrdavkelap.
00463361   1/1  gvdGfRlDaakhl..................paeflpelldalrelnalvdpvkpdvflvaEvwdggpel
00519751   1/1  flvgEvwdgnelllsflpgipeindeytdaprvfllgdlgglgfdsvfnfpalsddllealkysgeapdl
00514811   1/1  dGFRlDaakhm.................ppdflkeilealkelnelvfpvgpdvflvgEvwdggpevlap
00465591   1/1  vgEvw..lgllnallfgeypgilliaewndafrdvlryflrggelgsvfdfallgllldalalfllldgd
00461521   1/1  vreylldvllywl.elgvDGFRlDaakhlpkd........................flkelrdavr.elp
00489591   1/1  lywl.eygvdGfRlDaakhl........................pheflkelrdavrev.pdvfliaEvw
00494241   1/1  fRlDaakhl........................pveflrelrdavralgpdvflvgEvwdggpevl....
00465051   1/1  GfRlDaakhl........................pveflrelreavrelnpdvflvgEvwdggpell...
00361981   1/1  eflldvllywl.elgvdGFRlDavkhl........................pvdflrelrdavke.gpdv
00461391   1/1  reylldvlrywl.eygvDGFRlDaakhlpkd........................flkelrdavr.vgpd
00507601   1/1  FRlDaakhlpk.................eflpeliealrelnalvdavgpdvfligEvwdggpevlsyyg
00462661   1/1  glpdlnyenpevreylldvllywl.eygvdGfRlDaakhl........................pheflr
00407891   1/1  vDGFRlDavkhllkdlglrdlpllglyneyggltnlpepheflrelreavralap.vflvgEvwtgdpel
00407001   1/1  hl........................phdflrelrdavkelagpdvflvgEvwdggpellll....glgl
00460231   1/1  ywl.eygvDGFRlDaakhlpke........................flkelreavrevypdvflvgEvwd
00482421   1/1  RlDaakhlpkd........................flrelrdavra.....flvaEvwdggpevlrp..y
00529621   1/1  dGfRlDaakhl........................pveflrelrdav.....dvflvaEvwdgdeevlly
00475451   1/1  hlp........................leflkelldalrelrallgdpvgpdvflvaEvwdggpellryl
00472461   1/1  rncdllglpdlnyenpevreelldvllywldeygvdGfRlDaakhl........................
00517331   1/1  vdGfRlDaakhl........................pveflrelrdav.....dvflvaEvwdgdpevla
00529131   1/1  rlfdllglpdlnyenpevreelldvllywldeygvDGfRlDaakhl........................
00469481   1/1  ......................pveflrelrdavr...pdvflvaEvwdggpellayl..gglgfdavfn
00498361   1/1  ................ppeflkelldalkelvlvgpdvflvgEvwdggpelll....eylgldsvfnfpl
00458281   1/1  kdflrelldalpelhgllellrallvl...........pdvfliaEvwdagpellrylgylgglgfdsvf
00472361   1/1  .pkdflrelldalr.........eahlilellnelvealgpdvylvgEvwsgdpgelldylegglgfdav
00464551   1/1  lhlfllglpdlntenpevrdelldvlrywleelgvdGFRlDaakhl........................
00491241   1/1  gvdGfRlDaa.khlpkdygts...........cenleflaeilkalrell..lgpdffivgEvwtggeea
00523761   1/1  ylhlfllglpdlntenpevreelldwllywleelgvdGFRlDaakhi.......................
00485301   1/1  lflgglpdlntenpevrdylldvlrywleelgvdGFRlDaakhi........................pp
00469631   1/1  ylldwlrywleeygvDGFRfDaakhldpd........................flkefldav...gpdvf
00442811   1/1  gyfllglpdlntenpeVreelldwlrywldelgvdGfRlDavkhv........................d
00525851   1/1  ....................................................................lp
00408421   1/1  ----------------------------------------------------------------------
00500041   1/1  knykdgprvdawevgNEpnlg.............gwfgggvdaddlaeflreaadairaadpdapviveg
00481161   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00461221   1/1  lrea.adairavdpdapvivggynwsgdltladlaplgdpidfigl.........HyYppfggtgniaga
00517371   1/1  dlldllrelaeaaralgpdlililkngfeilrsdlpglqdyvdfvvvenlftydyllvsesdldwllpll
00465581   1/1  ----------------------------------------------------------------------
00491621   1/1  vigwevgNEpng.................................ggdfdadelaeylraaadairaadp
00459451   1/1  ----------------------------------------------------------------------
00462291   1/1  ----------------------------------------------------------------------
00460221   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           TFSMVYHYSEKFILSISHDEVVHGKKSLINKMWGDLWNKYAGLRLYMSYMIGHPGKKLIFMGSEFVQFVE
00481171   1/1  dgltlglllapseavnflenHDeprlgsrsgngllegdtylrlarlklalallltlpGipliyyGdelgl
00381231   1/1  elsliewdevrgqyylhlflkglpdnyenpevreflldvllyWleeygvDGFRlDavhslp.........
00392181   1/1  wdgggeglp...ggldgpenydfldelrdalkgeapdvltlaealtgspdlfeelvleaklpvllgglgf
00459471   1/1  pgllqpy..gglgldavfnfglrdalrgalkgdnglrldlgdlaklltgsldlypeggllplaavnflen
00469241   1/1  lykdlgrndg...........nlpepheflrelrdavrelgpdvflvgEvwtgpgellsyl..gglgfds
00444691   1/1  ellryyqlggrlgfdavfnfplrdallealakllgdpgsleeladiltgslllypdperavnflenHDtp
00474911   1/1  gpevlayygfgglgndsvfdfllmfllldalsggelallllillllf.lllapsravnfldnHDtprlad
00475911   1/1  Evwdggpelllylgelglvfdfplfrdllrdalrgeslgylldggdlselanrltglpdgllgafpenav
00471171   1/1  dpelllyygrgalrdllaglgfdsvfnfplrdallgalkgdgdlreladllltllglyaglepfrlvnfl
00422241   1/1  vfligEvwdggpellrgyeeggglgfdsvfnfplrdallealrggglsladlaniltgslllyrdpsrav
00463361   1/1  lryleeggldsvfnfplrdalrdalrggnlellrrllnsldlt...gyldpenavnfldnHDtpr.....
00519751   1/1  rdilvnlltasdglaptnlvnflenHDev..rlrsllsrlasllelrlallklalallltlpGipliyyG
00514811   1/1  yldg..gldsvfnfplrdalldafrgdnlgdladlanrltgllylypenavtfldnHDtqrlasll...g
00465591   1/1  lrdlrdillglaldyltpedlvtflenHDep..rlasllggll..tylrlarlklalallltlpGipliy
00461521   1/1  dvflvgEvwdggpevlayyqlggglgfdsvfnfplrddlldafrgdnglrlllalrllgslllyldpara
00489591   1/1  dggpevlryylkgg.gfdllllsvfnfplrdllldalrgeggslsdlanrltgsldlalpperavnfldn
00494241   1/1  .gylgfdavfnfplrdallgalrgddgslsdladlltgslallgaldptlavnfldnHDtp.....rlad
00465051   1/1  ..gylgfdavfnfplrdalldalrgddgslsdladlltgslvlygardpalavnflenHDtp.....rla
00361981   1/1  fligEvwdggpealaaylnagglgfdsvfnfdlrdallgalrgeplslsdlanlltgslvlypdperavn
00461391   1/1  vflvgEvwdggpevllyyqlggglgfdsvfnfplrddlldalkggngsrlllalrllgslllyldparav
00507601   1/1  yg...fdavynfplrddlldallgglggrlllallllasllyllllldplalvnfldnHDtprlasllgg
00462661   1/1  elrdavrel.pdvflvgEvwdggpeglsrygnagglgfdsvfnfplrdalldalrgeggslselanrltg
00407891   1/1  laayvnagglgldavfnfplrdallealakwrggdgdlsdladiltgslalyadperavnflenHDtpr.
00407001   1/1  davfnfplrdllldalrggsladladilegsl..llapsravnfldnHDtprladllgl........ldl
00460231   1/1  ggpevla.....yygfdgewnyafydfllalllgdallrgllallltlslllalaldpalavnflenHDt
00482421   1/1  gglgfdavynfplrdllldalrggdlsrladilggtpgllprdperavnfldnHDtprl...........
00529621   1/1  flgg...fdsvfnfplrdllldalrgdplslsdlanrltgsldlypdperavnfldnHDt..prlasllg
00475451   1/1  ..gglgfdavfnfplrdllldalrggell.dlldrlggslglydpsaavnfvdnHDtprlgdrlgltlkd
00472461   1/1  pheflkelrdavrelygpdvflvgEvwdggpellrgylggglgfdsvfnfplrdalldalkggelsdlad
00517331   1/1  gyln...gldavfnfplrdalldalrggkgdlsdlaniltgsldlypdperavnfldnHDtprladllgl
00529131   1/1  ppeflrelrdavrelygpdvflvgEvwdggpelllpylggglgfdsvfnfplrdalldalrggelad..l
00469481   1/1  fplrdllldalrggelarlkdildltlaldparavnfvd..nHDnprladllgllllelddrllkla...
00498361   1/1  rdalldafrgdngdlkdlldrll....lldpelavnfldnHDtvrladllg.......tlldlallklal
00458281   1/1  nfplrdalldalrgepgdlrdlanrl.tgllylyperavnfldnHDtp.....rlasllggd....lall
00472361   1/1  fdfplldllldal.rgslldlrdllnrllsllylppenavnfldnHDtp.........rladllglrlal
00464551   1/1  dpdflkelrdalrelagpdvflvgEvwdggpellayylgggggldavfnfplrdalrdalrgd..dlldl
00491241   1/1  lsyfnggglgfdfpl.rgllldalkggdldrlkd..........wlggwperavtfvdnHDtq.....rl
00523761   1/1  .dpdflkelrdavrelagpdvflvgEvwdggpellayylgggggldsvfnfplrdalrealkggdlld..
00485301   1/1  dflkelrealrelagpdvflvgEvwdggpellayyldggggldavfnfplrdalrdalrggdlld..lad
00469631   1/1  lvgEvwdggpellqdyeyggggfgygwaegndslfdfvlkfalgdafsggeladlllnsltglggldpsk
00442811   1/1  adflkefldalrelagpdvflvgEvwdgdpevllyyvgggdgldsvfdfplldalldalaggdll-----
00525851   1/1  ldfglmggllgafvhnly..gllylralydalrellpgkrpflltrsgnhgsqryaslwtgDnts-----
00408421   1/1  ----------------------------------------------------------------------
00500041   1/1  agglpgstdped.........fdlelladnvDfigvhyYP............................yg
00481161   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00461221   1/1  ltsfggvtgplpvsdlafgv...lgwmndglpylivgewsraltdssilpsglrallewl.arygk.Pvf
00517371   1/1  lalraa..gkpvfgidYadghdralvgdktlae-------------------------------------
00465581   1/1  ----------------------------------------------------------------------
00491621   1/1  dapvtvgdagdypaswrpflggrlpeftdldlalladpvDfigvhyYps.....................
00459451   1/1  ----------------------------------------------------------------------
00462291   1/1  ----------------------------------------------------------------------
00460221   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           WREYEQLQWQVVDQYESHKQTLHFFKKLNDLYHNETALWQCDYDHHGFRWIDADNSQQSILSFIRSSKDN
00481171   1/1  tnaydpdnrrdwmlwdllldddksllnfyrklialrkehpalrr--------------------------
00381231   1/1  ...............leflrelreavreinpdvlliaE--------------------------------
00392181   1/1  dykllmgllddllralaellaadpvyryylggrlelsmafnf----------------------------
00459471   1/1  HDeprladllvvngkhslangepgdnrdglndnlslgngaegd---------------------------
00469241   1/1  vfnfplrdllreal..dggnlsdlanlltgslgylppenavnfldnH-----------------------
00444691   1/1  r.....lldllggdlelrrarlklaaallltlpGipliyyGdElgltgpvdpdnreyldwetlll-----
00474911   1/1  llgl.........rlarlklaaallltlpGipliyyGdEl------------------------------
00475911   1/1  nfldnHDtp.....rladllggd....lallklalallltl-----------------------------
00471171   1/1  dnHDtv.....rlasllggdlar....lklalallltlpG------------------------------
00422241   1/1  nfldnHDtprlgdllg..........raallklalall--------------------------------
00463361   1/1  llsalggsvdtaldlallrlalallltlpyGipliyssyGdelgltgdgdrdnrrdw-------------
00519751   1/1  delgltnglnnnaygrddartpmdwdllslnagfsnalsgelvdpwlpv---------------------
00514811   1/1  dplltlldlallklalallltlpyGipliyssyGdEi---------------------------------
00465591   1/1  yGdelgltndgdpnddlgdpelinavreglgleglllll-------------------------------
00461521   1/1  vnfvdnHDtprlasllg.........aarlklaaallltl------------------------------
00489591   1/1  HDt..........prladllgdlarlklalallltlpGip------------------------------
00494241   1/1  llggderl....lklalallltlpGipliyyGdelgltgl------------------------------
00465051   1/1  dllggdlal....lklalallltlpGipliyyGdelgltg------------------------------
00361981   1/1  fldnHDtvrl..........ldllgrlallklalallltl------------------------------
00461391   1/1  nfvdnHDtprlasllg..........dlallklaaalllt------------------------------
00507601   1/1  d....larlklaaallltlpGipliyyGdElgltglgdpd------------------------------
00462661   1/1  sldlypdptravnfldnHDtp..rlasllgdl........arl---------------------------
00407891   1/1  ....ladllgglsvllrarrlklaaallltlpGipliy--------------------------------
00407001   1/1  allklalallltlpGipliyyGdefgltglldpdnrdnvr------------------------------
00460231   1/1  prladllgl.........glarlllalallltlpGipliy------------------------------
00482421   1/1  ......arlrlalallltlpGipliyyGdelgltgpg......................firklialRk.
00529621   1/1  dld........rlklalallltlpGipliyyGdelgltglgddnnrtpmd--------------------
00475451   1/1  g......allrlalallltlpyGipliyyGdelgltgqgdpg----------------------------
00472461   1/1  r..lggslgylppenavn----------------------------------------------------
00517331   1/1  ...........larlklalallltlpGipliyyGdelgltglgd--------------------------
00529131   1/1  adllggslgllppeaavnfv--------------------------------------------------
00469481   1/1  ..lallltlpyGipliyyGdelagltgqgdp.nrldlrli------------------------------
00498361   1/1  allltlpyGipliyyGdefgltgggdpnartpldw..---------------------------------
00458281   1/1  klalalllt-------------------------------------------------------------
00472361   1/1  lklalallltlpG---------------------------------------------------------
00464551   1/1  adilagslgllpperavtfldnHDtqr.......------------------------------------
00491241   1/1  adlegglldeeiktlddalplalllaa.........ipliyyGdefgltgdgnpyndpydinpldwsald
00523761   1/1  ladilagslgllppelavtfldnHDtqr.........---------------------------------
00485301   1/1  ilagslgllpperavtfldnHDtqr.........------------------------------------
00469631   1/1  avtfvdnHDtqrlad-------------------------------------------------------
00442811   1/1  ----------------------------------------------------------------------
00525851   1/1  ----------------------------------------------------------------------
00408421   1/1  --------------------------------------------pegfewidlddeensvlaflRlgkd.
00500041   1/1  ftlfdddgsglslesgwdidpdglrallellkrygkP.ifig.E--------------------------
00481161   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00461221   1/1  itEfGlpgagddeeraey..lkalldallkagv.gwffWsl.dn......................----
00517371   1/1  ----------------------------------------------------------------------
00465581   1/1  ----------------------------------------------------------------------
00491621   1/1  ...........pdgggtsaegleadpdglld---------------------------------------
00459451   1/1  ----------------------------------------------------------------------
00462291   1/1  ----------------------------------------------------------------------
00460221   1/1  ----------------------------------------------GdyellladdddnvfaylRtled.


                         -         -         -         *         -         -         -:630
query           KQKLIFICNFTPVTYYDYHLGVPDAGSYKEVFNSDNLEFGGSGQVMATEIFSSPQSSHGFEQRITIKIPP
00481171   1/1  ----------------------------------------------------------------------
00381231   1/1  ----------------------------------------------------------------------
00392181   1/1  ----------------------------------------------------------------------
00459471   1/1  ----------------------------------------------------------------------
00469241   1/1  ----------------------------------------------------------------------
00444691   1/1  ----------------------------------------------------------------------
00474911   1/1  ----------------------------------------------------------------------
00475911   1/1  ----------------------------------------------------------------------
00471171   1/1  ----------------------------------------------------------------------
00422241   1/1  ----------------------------------------------------------------------
00463361   1/1  ----------------------------------------------------------------------
00519751   1/1  ----------------------------------------------------------------------
00514811   1/1  ----------------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------
00461521   1/1  ----------------------------------------------------------------------
00489591   1/1  ----------------------------------------------------------------------
00494241   1/1  ----------------------------------------------------------------------
00465051   1/1  ----------------------------------------------------------------------
00361981   1/1  ----------------------------------------------------------------------
00461391   1/1  ----------------------------------------------------------------------
00507601   1/1  ----------------------------------------------------------------------
00462661   1/1  ----------------------------------------------------------------------
00407891   1/1  ----------------------------------------------------------------------
00407001   1/1  ----------------------------------------------------------------------
00460231   1/1  ----------------------------------------------------------------------
00482421   1/1  .---------------------------------------------------------------------
00529621   1/1  ----------------------------------------------------------------------
00475451   1/1  ----------------------------------------------------------------------
00472461   1/1  ----------------------------------------------------------------------
00517331   1/1  ----------------------------------------------------------------------
00529131   1/1  ----------------------------------------------------------------------
00469481   1/1  ----------------------------------------------------------------------
00498361   1/1  ----------------------------------------------------------------------
00458281   1/1  ----------------------------------------------------------------------
00472361   1/1  ----------------------------------------------------------------------
00464551   1/1  ----------------------------------------------------------------------
00491241   1/1  lda...gllrlirkLialrkghpalylgdllalg.....-------------------------------
00523761   1/1  ----------------------------------------------------------------------
00485301   1/1  ----------------------------------------------------------------------
00469631   1/1  ----------------------------------------------------------------------
00442811   1/1  ----------------------------------------------------------------------
00525851   1/1  ----------------------------------------------------------------------
00408421   1/1  gelllvvfnftpvsredYrigvplagtyrevLntDallygGsgvgnlgvvlaedlpwhgrpasllltlPp
00500041   1/1  ----------------------------------------------------------------------
00481161   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00461221   1/1  ----------------------------------------------------------------------
00517371   1/1  ----------------------------------------------------------------------
00465581   1/1  ----------------------------------------------------------------------
00491621   1/1  ----------------------------------------------------------------------
00459451   1/1  ----------------------------------------------------------------------
00462291   1/1  ----------------------------------------------------------------------
00460221   1/1  .etvlvvlNfsdeeqtvtlplnlleggtlvdllsge....................elsvldglltltLp


                         -         +         -         -         -         -         *:700
query           MATLVLKLIK------------------------------------------------------------
00481171   1/1  ----------------------------------------------------------------------
00381231   1/1  ----------------------------------------------------------------------
00392181   1/1  ----------------------------------------------------------------------
00459471   1/1  ----------------------------------------------------------------------
00469241   1/1  ----------------------------------------------------------------------
00444691   1/1  ----------------------------------------------------------------------
00474911   1/1  ----------------------------------------------------------------------
00475911   1/1  ----------------------------------------------------------------------
00471171   1/1  ----------------------------------------------------------------------
00422241   1/1  ----------------------------------------------------------------------
00463361   1/1  ----------------------------------------------------------------------
00519751   1/1  ----------------------------------------------------------------------
00514811   1/1  ----------------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------
00461521   1/1  ----------------------------------------------------------------------
00489591   1/1  ----------------------------------------------------------------------
00494241   1/1  ----------------------------------------------------------------------
00465051   1/1  ----------------------------------------------------------------------
00361981   1/1  ----------------------------------------------------------------------
00461391   1/1  ----------------------------------------------------------------------
00507601   1/1  ----------------------------------------------------------------------
00462661   1/1  ----------------------------------------------------------------------
00407891   1/1  ----------------------------------------------------------------------
00407001   1/1  ----------------------------------------------------------------------
00460231   1/1  ----------------------------------------------------------------------
00482421   1/1  ----------------------------------------------------------------------
00529621   1/1  ----------------------------------------------------------------------
00475451   1/1  ----------------------------------------------------------------------
00472461   1/1  ----------------------------------------------------------------------
00517331   1/1  ----------------------------------------------------------------------
00529131   1/1  ----------------------------------------------------------------------
00469481   1/1  ----------------------------------------------------------------------
00498361   1/1  ----------------------------------------------------------------------
00458281   1/1  ----------------------------------------------------------------------
00472361   1/1  ----------------------------------------------------------------------
00464551   1/1  ----------------------------------------------------------------------
00491241   1/1  ----------------------------------------------------------------------
00523761   1/1  ----------------------------------------------------------------------
00485301   1/1  ----------------------------------------------------------------------
00469631   1/1  ----------------------------------------------------------------------
00442811   1/1  ----------------------------------------------------------------------
00525851   1/1  ----------------------------------------------------------------------
00408421   1/1  laalvlkleke-----------------------------------------------------------
00500041   1/1  ----------------------------------------------------------------------
00481161   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00461221   1/1  ----------------------------------------------------------------------
00517371   1/1  ----------------------------------------------------------------------
00465581   1/1  ----------------------------------------------------------------------
00491621   1/1  ----------------------------------------------------------------------
00459451   1/1  ----------------------------------------------------------------------
00462291   1/1  ----------------------------------------------------------------------
00460221   1/1  Pyealvllle------------------------------------------------------------