[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30613.1


[Show Plain Result]

## Summary of Sequence Search
   1::528
  13::523 3.3e-131 36.1% 0047996 00479961 1/1   inked oxidoreductases                   
  11::511 6.2e-124 35.7% 0046501 00465011 1/1   inked oxidoreductases                   
  56::483  8.7e-63 28.8% 0048029 00480291 1/1   inked oxidoreductases                   
 135::456  7.9e-43 27.9% 0049708 00497081 1/1   inked oxidoreductases                   
  59::485  3.1e-40 24.1% 0049587 00495871 1/1   inked oxidoreductases                   
 115::485  1.4e-37 24.7% 0050135 00501351 1/1   inked oxidoreductases                   
  98::427  1.6e-31 24.2% 0046721 00467211 1/1   inked oxidoreductases                   
 128::486  2.8e-17 22.1% 0047242 00472421 1/1   inked oxidoreductases                   
 115::488  5.5e-16 23.7% 0047026 00470261 1/1   inked oxidoreductases                   
 112::490  7.7e-16 19.1% 0046530 00465301 1/1   ne monophosphate dehydrogenase (IMPDH)  
 140::412  2.1e-14 25.4% 0051899 00518991 1/1   inked oxidoreductases                   
 126::505  1.1e-12 21.7% 0042110 00421101 1/1   inked oxidoreductases                   
 134::417  1.4e-10 22.0% 0047561 00475611 1/1   ne monophosphate dehydrogenase (IMPDH)  
 141::450  9.4e-10 16.9% 0052481 00524811 1/1   inked oxidoreductases                   
 233::423  1.2e-07 24.7% 0039482 00394821 1/1   ase                                     
 134::417    2e-06 21.6% 0051569 00515691 1/1   ne monophosphate dehydrogenase (IMPDH)  
 282::417  5.8e-05 20.5% 0048832 00488321 1/1   ne monophosphate dehydrogenase (IMPDH)  
 294::412  0.00024 26.5% 0036258 00362581 1/1   inked oxidoreductases                   
 295::413  0.00026 23.0% 0047140 00471401 1/1   inked oxidoreductases                   
   1::528


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHISERRKWYIGFAVFVMVILLSLSLLHASIWFSIGFVAVLAVIAIYDVSQTKHSILRNFPIVGHMRYIL
00479961   1/1  ------------ddeellrlqkafgytledlellllplaesgkepigsmGddtPlavLsdkprllydyFk
00465011   1/1  ----------llkledllellsllledlllddaellklqkafgytledlellllplaesgkepvgsmGdd
00480291   1/1  -------------------------------------------------------delllllglrllyll
00497081   1/1  ----------------------------------------------------------------------
00495871   1/1  ----------------------------------------------------------nllsladleala
00501351   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00472421   1/1  ----------------------------------------------------------------------
00470261   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00421101   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00488321   1/1  ----------------------------------------------------------------------
00362581   1/1  ----------------------------------------------------------------------
00471401   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EFLRPEIQQYFIADNESEKPFGRELRSTIYRRAKGINDTVAFGTEKDIYRVGYEWVTHSLMPKHLDEIET
00479961   1/1  qlfAqvTnPPiDplrEelvmslltllGpegnlleedeesarrlllesPvLsneelekllnpglktltldl
00465011   1/1  tPlavLsdkprllydyfkqlfAqvtnPPiDplrEelvmslltllGpegnlleedeelarrlllesPvlsn
00480291   1/1  elllpelrqylsladleelafrrlprslfdyldggaddeltlgrnlaafd.dvllrprvl..vdvddvdl
00497081   1/1  ----------------------------------------------------------------lnlldl
00495871   1/1  krrlpkrkfdyldggagdevtlrenrlafdd.....................vllvprvlp..dvsdvdl
00501351   1/1  --------------------------------------------rnllafddvllvprvlpevdvsdvdl
00467211   1/1  ---------------------------alrrllrpllfylddevtlrlnllafddilllprvlpdvsldv
00472421   1/1  ---------------------------------------------------------prvlv.dvsdvdl
00470261   1/1  --------------------------------------------esllnladlealarrrlpkrkfdyld
00465301   1/1  -----------------------------------------ltlrrnlltfddvllvprvltvlsldvdl
00518991   1/1  ---------------------------------------------------------------------D
00421101   1/1  -------------------------------------------------------vpralpdvdlsevdl
00475611   1/1  ---------------------------------------------------------------lvfdYld
00524811   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00515691   1/1  ---------------------------------------------------------------addeltl
00488321   1/1  ----------------------------------------------------------------------
00362581   1/1  ----------------------------------------------------------------------
00471401   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RVKIGGSDCKQPYMASHLNISAMSFGALSANAVMALNKGAKLGGFYQCTGEGGLTKYHLQGGDLVFQIGT
00479961   1/1  lfdvelgegleealdrlleeaeeavregasilvLsdrllgelldedrlaipallavgavhhhLireglrt
00465011   1/1  eelekllnldglkvltldllydvelgaegleaalerlleeaeeavrdganililsDrdlsedrlaipalL
00480291   1/1  sttilglklknP.....lvlapmgfgglsepieaeialaraaaelgggipiilgemgnvsle.rlaaavs
00497081   1/1  ralalrrllrpllfyldgetahrltlaflrigllprvlvvsdvdlstellglklknP.....fglapm.g
00495871   1/1  sttllgiklslP.....liiapmggvtllspdgepalaraaaraGglgvlgsgslglee....evrkakp
00501351   1/1  sttllgltlknP.....liiapmgggtlsapagnpalaraaaraGglgvigsgglgsle........ela
00467211   1/1  dlsttllgltlknP.....lvlapmtvtdaelaialaalgaglivlgtvtveplegnvsprllrlpedea
00472421   1/1  sttllglklslP.....lviapmagvtllhpdgeaalaiaaaeaGglgvlgtgssasieevkkaapgpli
00470261   1/1  ggagdevtlrrnrlafddvllvprvlpdvsdvdlsttllglklslP.....liiapmagvtllhpdgeaa
00465301   1/1  sttltgllglkiP.....iiiapmggvaepe.....laiavakaGglgvlggglspeelaeeirrvkel.
00518991   1/1  lstellglklknPiglApm...gvskdaeaiaalaagglGiielgtvtlapqegvtdprvrrlgaglinl
00421101   1/1  sttllglklslP.....liiapmtggtgllspegelalaraaaeagilgvlgslssllleeiaaellrvv
00475611   1/1  ggagdeltlrrnrlafddvllvPrvltvldvsevdlstlllglglkiP.....iiiapmagv.....sep
00524811   1/1  lLsttllglklknPlglaa...glvdkdaeailalaalgfgiielgtvtlapmagvtdprlrrlgaglln
00394821   1/1  ----------------------------------------------------------------------
00515691   1/1  rrnrlaFddvllvprvltvldvsevdlstlllglglkiP.....iiiapMggv.....geaalaaaaaka
00488321   1/1  ----------------------------------------------------------------------
00362581   1/1  ----------------------------------------------------------------------
00471401   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GYFGCRTDDGKFSAEKFVEKANLDSVKMIEIKLSQGAKPSHGGVLPAAKITPEIAEIRGVSMGKDVLSPP
00479961   1/1  kvslvvetgearevhhfavllGyGAdavnPylaletlldlleeglleelleegkledldleeavlnyika
00465011   1/1  avgavhhhLireglrtkvslvvetgearevhhfavllGyGAdavnPylaletlldlleeglldgldleea
00480291   1/1  gagglgsfglyalgdlevleellrrakaagikpigvnlg...kpgeggalaaikvseagadaidlnlgap
00497081   1/1  dknlelaralaalgaglvvtgtvtpvpqegnpkprlfrlpedealinlyglnnegldallerlkalkall
00495871   1/1  dgplivnlyaskdrgvlaelleraeeag.adaivltvdspllgqrardlrggfllglkvtaeilalrlvp
00501351   1/1  eairrvrdlap.............ggplgvnlggaqdaepgveeaaraaeeagadalelnvdlpql.gsr
00467211   1/1  iinlygln..........dpgl.eellervkaagikipvganlgvdeilplgarvedfaeaarlaeegad
00472421   1/1  vqlyvl.....dretteellkraeaagadal.vltvdapllgirerdlrlgfglppglgglntldlvvip
00470261   1/1  laraaaraGglgvlgsgslapee.....evrkaapgpfgvnlyglkdpellaellrraeaagadaivltv
00465301   1/1  esgfinsplwfqlyllpfgvdlllellarataagikalvltpdapklglgrllvganvgvppdlaervea
00518991   1/1  eglnnrgle.............alllelakaagi.kglplgvniggsgpeelaeaakllvrlleagadai
00421101   1/1  rdaapdlpvfanlgvpgd.............teelleaaeaagadalvldvdapqegvrleglr......
00475611   1/1  alaiaaakaGglgvlgaggstpeealaealvkralt.........................llplavklg
00524811   1/1  reglnndgleaalkllrralkagkpglpvgvnlggnr.....pedlaeaarlleea.gadailelnlgcp
00394821   1/1  ----------------------lkgagllevkiatvigfplGgslldvkva.eae..aaveaGadeidlv
00515691   1/1  Gglgvlgaggstpeeavaaaavkkal.....................................akkllgg
00488321   1/1  ----------------------------------------------------------------------
00362581   1/1  ----------------------------------------------------------------------
00471401   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AHSAFSTPIEFCYFIKQLRDLSNGKPIGFKLCIGSHVEFLAICKAMLETGIRPDFITVDGADGGTGAAPL
00479961   1/1  lekgllkilskmgistlasylgaqlfealglslelvdllflgtasrilgigllllakeailrnypavgrl
00465011   1/1  lknylkalekGllkimskmGistlasylgaqlfealglsllvvlllflgtlsrigglll..heilrnypv
00480291   1/1  lvdpvvdvgsistlggdpelvledlkalreavg.vpvivKlvp..tved...AkaaeeaG..aDaivvsg
00497081   1/1  llllleaggplivqiggsglfgsrpedlaeaaelle.....pladaielnlscPakpglggllgaalled
00495871   1/1  pgealispahg....dpilsledlkalrealg.vpvivkgvl..tved...allaaeaG..adaivvsgh
00501351   1/1  eld....rprlllellealreavg.vpvivKlvggvltv..edaralleaG..adaivvsgggggghidv
00467211   1/1  aielnfssPnlpnlrsdeyggslenrprllleiikavreavgedvpvivKlspgldvediedlakaleea
00472421   1/1  egrllg..advilldaahg....dplllleliealrealg.vpvivkgvatv.....edarraleaG..a
00470261   1/1  glpvlgvrerdlrlgfllppaaggalladlaralalvlagadelvlvvs......dgdpeglleliealr
00465301   1/1  lveagvdvivldtsagh....pelllelikrlkeatpgvpviakgvat.....vedAlaaveaG..aDai
00518991   1/1  elnigcpntgggaallldpelllelikalreavg.ipvivKirpgidtaedveiakaleeaG.ladaiiv
00421101   1/1  ........................dpslvlddikelkelvpvpvivKgvgnvltvedalllaeaG..ada
00475611   1/1  lgalpvaaavgagtavllraaalleagvdvividvapgsdpsllwdllaikrl....kpkgpvvvkgvat
00524811   1/1  ntlggsallkdpelllelleavkeav.dvpvivKispgvgiediediakalveaG..adaivvsntthgg
00394821   1/1  inlgallsgdpeevleeiravveaakdlgvpvkviletglltdveflveaaraaaeaG..Adfikvsd..
00515691   1/1  aapgalvdaaeravalleagadaividvahgvstslgwpdlkilrl.....kpvgpiv..aggvltvedA
00488321   1/1  -dtahghpellielikalkeaypdegpviagnvat.....veaalalidaG..aDavkvgggeg..sght
00362581   1/1  -------------likalkeavg.lpvivklapgltgvdt..velakraeeaG..adavvvsnttggrgl
00471401   1/1  --------------vkavreavg.ipvivKlrpggd.dtvelaraaeeaG..adgiivhnrtgtqlidve


                         -         -         -         -         *         -         -:420
query           EFSNHIGMPLEDSLIFVHNALVGCGLRDEIRIIASSKVATGFDMVRLFAMGADTCNSARAMMLAIGCIQS
00479961   1/1  ryllevlg..lrqyrl..dgeehpfnplersalqraak.vldyiafgaddevytlfdnylalnrslpprv
00465011   1/1  lgrlryllesirlelggyfllrdlgelhfnrperilvlqrakgagdeitfgenrllfddrillplrslld
00480291   1/1  .aGGtg.......ldvgpptlealaevaealgelglrgripviadGGirtgedaakalalGAdaVmvGra
00497081   1/1  fiaaarraveagadiielgiasgylldgfliplanlraleyGndpelllelikalreavg.vPlvivKir
00495871   1/1  ggggl........dvgvptlealpevaeav.....ggdipviadGGirtggDvakalalGAdaVmiGraf
00501351   1/1  etlravgaattggllgvgvptlallaevreal......gdipviadGGirtgedaakalalGAdaVlvgr
00467211   1/1  Ga..daiivsngigggtgltplelagvhgglsglplapaslevlaelrea.vggripviadGGirsgeda
00472421   1/1  daivvsghggggl........dvgiptlaalpevveav.......dvpviadGGirtggdvakalalGAd
00470261   1/1  eatg.vpvivkgva..tved...araaaeaG..adaivvsggggggl........dvgvptlealpevae
00465301   1/1  vvggggGggltgrev..lgvgvptltalpevadavk....grdipviadGGIrtggdvakalalGAdaVm
00518991   1/1  snrtggtlaadigpgsllttrlvehgglsgdalpplalellaevaeav.g.....dipviad--------
00421101   1/1  ivvsghgGrqldavevarsicttrlvagvglptltallevaeavg......gipviadGGirtggdvaka
00475611   1/1  ved.....AkkaeeaG..aDaivvsgggggghtgrlstgvllpq......ivavrlvaeaavgvdip---
00524811   1/1  rqldiegvdlivaqgpeagglsGnalapaaleliaeiada.vkgdipviadGGIrsgedaakalalGAda
00394821   1/1  Gg..........tvggatpeavallvealrevavgvkipvhasGGirtdedaakalalaaveaGadqvga
00515691   1/1  rkaveaG..aDaivvsghgggghtgreatgvglpqitavalvaaaav......gvdipviadGGIrd---
00488321   1/1  grvvdgvgvpqltalpevadavreyleegglgipviadGGirdggdiakalalGAdaVmlGtrfagt---
00362581   1/1  dgttrrvaeagglsGaplkpaslellreiaea.vggdipviadGGIrtgedaakalaaGAda--------
00471401   1/1  arkallglglgsinetgglsgpaippaaleliaevreav..pgipvianGGIrtgedaleala-------


                         -         -         +         -         -         -         -:490
query           RQCNNNTCPVGVATQNPRLEKALVVEDKMYRVYNFHKATIQSCLEIIGAMGLISTDDVEPENLKKRISVN
00479961   1/1  lrdlldvdlsttllgldevepplklslPfiispMsfGalspeaeealaraaaraGglgntGegglsperl
00465011   1/1  ..vslvdtsttigevelglklsaP.iiiapMsfGalspeaeealaiaaaraGglgnlgegglspeelalr
00480291   1/1  flgapea.............................ggpegvknllealleelrlimallGvr-------
00497081   1/1  pglsvedieeiakaleeaGa..dgiivsnttagghg----------------------------------
00495871   1/1  lyaleapge.............................egvknlleallgelrlamallGarsle-----
00501351   1/1  allyaleagge..............................gvpkllealleelrlamallGars-----
00467211   1/1  akalalG---------------------------------------------------------------
00472421   1/1  aVlvGtaflyaleapge.............................egvknvleallgelrltmal----
00470261   1/1  av.....ggdipviadGGIrtgedvakalalGAdgVlvGtaflyaleapge.................--
00465301   1/1  iGtaflgtleapgeevykdgvltklyrgmpsrgamnrlsldvylleegdadklllpeGveglvpyvggva
00518991   1/1  ----------------------------------------------------------------------
00421101   1/1  lalGAdaVgiGraflyaleapge.............................egvvnvlellleelklam
00475611   1/1  ----------------------------------------------------------------------
00524811   1/1  VmiGraflyt.gpalveeilkelrlamall----------------------------------------
00394821   1/1  dav-------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00488321   1/1  ----------------------------------------------------------------------
00362581   1/1  ----------------------------------------------------------------------
00471401   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EIKSYADLYDFIPERCLVDGNIPASFARSWEKARADSF--------------------------------
00479961   1/1  esledvvaaigdgyffqlyrlkdgdlarslikq-------------------------------------
00465011   1/1  angagikslikqvasgrfGvr-------------------------------------------------
00480291   1/1  ----------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00495871   1/1  ----------------------------------------------------------------------
00501351   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00472421   1/1  ----------------------------------------------------------------------
00470261   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00421101   1/1  allGaksieelrgsl-------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00515691   1/1  ----------------------------------------------------------------------
00488321   1/1  ----------------------------------------------------------------------
00362581   1/1  ----------------------------------------------------------------------
00471401   1/1  ----------------------------------------------------------------------