[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30665.1


[Show Plain Result]

## Summary of Sequence Search
   1::354
 118::338  4.6e-65 39.6% 0037998 00379981 1/1   e finger endonucleases                  
   1::354


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTKKTSKQKDTKKQTTKKPINYIKIFILLALTIGGGFSGIFFDKFDLKEKFINFRHAVYNYFTSEPIKHY
00379981   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TTKDNENITARFFSQSDEGKKQQQQSNEFDNLKQYPPVRTLPAVTDYCHGFLAYGNPSYGVTDGLGQANL
00379981   1/1  -----------------------------------------------cgdflllgfplvg......igqd


                         +         -         -         -         -         *         -:210
query           YLCRDGYVVGYNYQTKEASWVAFELTKSKVANHLKRDDRFKEDSDVPFVYRATLDDYSRSGYDRGHLASY
00379981   1/1  llfyelyavcydrrtriplyvayhltgssla..vkrpdsffadprlpglyqavledYknsdsglgydRGH


                         -         -         -         +         -         -         -:280
query           ASMDFSKKSADQSFLLSNMSPQKAGLNRQGWERLETDERIWANMYDSIYVYTGPIYKKQKIHKTIGDNKI
00379981   1/1  laPaadfvfsq.aqlaTFlltNvvPQvpgfNrgnWarlEnyvrdlakkyglgevyVvtGplflpdllilv


                         -         *         -         -         -         -         +:350
query           AVPDYFFKIIYVPSKNQAIAFVMPNARVEKTKIANYRVSIKDIEQCTGLHFLTNISNRDAVINSVSSMWR
00379981   1/1  igknkvavPthfwkvvvdedsdgglaliafvlpndpildadlkvfqvsvdelekltgl------------


                         -         -         -         -         *         -         -:420
query           TTYL------------------------------------------------------------------
00379981   1/1  ----------------------------------------------------------------------