[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30738.1


[Show Plain Result]

## Summary of Sequence Search
   1::287
   1::269    2e-60 34.8% 0051364 00513641 1/1   otide-diphospho-sugar transferases      
   1::277  2.6e-59 34.6% 0040693 00406931 1/1   otide-diphospho-sugar transferases      
   1::278  4.2e-58 30.9% 0044168 00441681 1/1   otide-diphospho-sugar transferases      
   4::269  2.5e-56 32.3% 0038427 00384271 1/1   otide-diphospho-sugar transferases      
   3::282  1.9e-55 32.1% 0046877 00468771 1/1   otide-diphospho-sugar transferases      
   4::283  1.1e-53 33.5% 0038005 00380051 1/1   otide-diphospho-sugar transferases      
   2::283  1.1e-52 33.7% 0038743 00387431 1/1   otide-diphospho-sugar transferases      
   1::270    6e-52 36.2% 0047707 00477071 1/1   otide-diphospho-sugar transferases      
   1::280  3.4e-49 29.7% 0047373 00473731 1/1   otide-diphospho-sugar transferases      
   1::277    1e-48 33.8% 0038462 00384621 1/1   otide-diphospho-sugar transferases      
   5::280  3.7e-47 29.8% 0048137 00481371 1/1   otide-diphospho-sugar transferases      
   4::274  6.1e-47 28.3% 0050195 00501951 1/1   otide-diphospho-sugar transferases      
   1::269  9.8e-45 29.9% 0038881 00388811 1/1   otide-diphospho-sugar transferases      
   1::269  2.5e-44 32.7% 0044743 00447431 1/1   otide-diphospho-sugar transferases      
   4::269  4.4e-40 31.2% 0050178 00501781 1/1   otide-diphospho-sugar transferases      
   4::269  8.8e-40 29.9% 0053095 00530951 1/1   otide-diphospho-sugar transferases      
   1::270  1.5e-36 29.9% 0050266 00502661 1/1   otide-diphospho-sugar transferases      
   1::269  5.3e-36 29.7% 0050387 00503871 1/1   otide-diphospho-sugar transferases      
   1::232  4.8e-30 29.4% 0046466 00464661 1/1   otide-diphospho-sugar transferases      
   1::270  3.3e-28 28.0% 0046659 00466591 1/1   otide-diphospho-sugar transferases      
   4::269  2.4e-16 23.4% 0050366 00503661 1/1   otide-diphospho-sugar transferases      
   1::259  3.2e-11 23.5% 0049057 00490571 1/1   otide-diphospho-sugar transferases      
   1::287


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKIRKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNKKSLEDHFDRN
00513641   1/1  lllllllmmkvmkavILAGGlGtRLrPlTkarPKpllpvggkyplidytlsrlanagieeivvvtgykae
00406931   1/1  lkimkAvILAGGlGtRLrPlTralpKpllpvagkPlieytlerlaaagieeivvvtgylalelieeylgd
00441681   1/1  mk.mkavILAgGlGtRlgplTsdlpKpllplggkPliehvlealaaagideivvvtgykaelieellgdg
00384271   1/1  ---mimkavILAaGlGtRLrpltralPKqllpvggkPliqytlerlaaagideivvvtgeylaelieell
00468771   1/1  --mmkavILAGGlGtRlrPlTsalpKpllpvggkPlieytlerlaaagideivvvtgykdaelieeylgd
00380051   1/1  ---kmkavILAaGlGtRlgplt...pKpllpiggkpllehvleallaagideivvvtgykaeaieell..
00387431   1/1  -mkmkavILAaGlGtRlgplt...pKpllpiagkpllehvlerllaagideivvvtgyddelieellg..
00477071   1/1  mmkmkavIlAaGlGtRlgplTsdlpKpllpvggkplieytleallaagideivvvtgykaelieellgd.
00473731   1/1  MmkmkavIlAgGlGtRlgplTsdrpKpllplggkpliqhtlerllaagideivvvtgykarelieellgd
00384621   1/1  Mk.vkavIlAaglGtRl.p.....pKpllpiaGkPliqhvieaalaagiidivvv.gtddeeiedaldky
00481371   1/1  ----hmkavIlAgGlGtRlgpltsdrpKpllplggkpliehtlerllaagideivvvtgykaleliaell
00501951   1/1  ---kmkavIlAgGlGtRl.p.....pKpllplggkpliehtlerllaagideivvvtg..deeiaellsk
00388811   1/1  mmkmkavilAAGlGtRmgp...dlpKpllplggkpllehvleallaaglideivvvvgygdeaieellad
00447431   1/1  mmkmkavilAAGlGtRlgp...dlPKqllplggkpllehvleallaaglideiivvvgykdelieellak
00501781   1/1  ---kmkavIlAaggGtRl.p.....pKpllpiagkPliahvleallaagideivvvtgd..eeiaealgd
00530951   1/1  ---dllrelleglllllklseldlesflalferlllellelldidlipllplelvvslldlellldleel
00502661   1/1  mmkmkaiIlAaGkGtRlgp...dlpKqllplggkplleytleallaaglideivvvtgyedelieell..
00503871   1/1  lkmkmkaviLAgGsGtRlgp...dlpKqllplagkpllqhtlerllaaglideivvvtgpedlelieell
00464661   1/1  MmkikavIlAgGlGtRlgp....lpKpllpiggkpliehvlerll.agideiivvtgykaelikkl....
00466591   1/1  MkkkilaiIlAagkGtRl.p.....pKpllpiggkpliehvleallksglideiivvtg..deeikeylk
00503661   1/1  ---kmaaiilAAGkGtRmgs...dlpKqllklggkpllehtleallslglidiivvvgneedlvlla...
00490571   1/1  pmkv.aAiIlArGggkrl.p.....pKnllplagkpliaytleallasglideivVvtdd..deiaevae


                         -         -         *         -         -         -         -:140
query           FELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPLVGIEDFAVILPDDLIYNHDC
00513641   1/1  siedhlgdgselgldlklgglfvll........lpanityvlepeplgtagalalaldllgdspdepflv
00406931   1/1  gselg......................vkityvlepeplgtagalllaldflgdepflvllgDhilldld
00441681   1/1  sellsdllldlklellellrllle.glkityvlqgeplgtagavllaldllgddepvlvllgDvpl....
00384271   1/1  gdgsel......................glkivyvvepeplgtagalllaldllgddpfvlvlngDilid
00468771   1/1  gsll......................gvkityvlepeplgtagavllaldllgddpflvllgDhplidld
00380051   1/1  ..........................glkvtyvvqpeplgtagavllaldalgddddpvlvllgDvplit
00387431   1/1  .........................dgnvtyvlqgeplgtagavllalellgddepvlvllgDvplvtpa
00477071   1/1  y........................gvkivyvlqpeglgtagavllaldll..ddvlvllgDvpllld..
00473731   1/1  gselgl......................kvvyvlegeplgtadavllalealgddpvlvllgDrplid..
00384621   1/1  .........................gvevvltre.dalgtgdavlealellgddpvlvlqgDvPlitpe.
00481371   1/1  gdgselg......................levtyvlqgeplgtadavllaldalgddpvlvllgDhplid
00501951   1/1  l.........................gvevvyvvedealgtgplaavlaalellgddpvlvllgDhplld
00388811   1/1  l...........................gilivlvegglgtggsvllalealgdadpvlvldgDrplltp
00447431   1/1  .l..........................girivlvegglgtggsvllalealgelllldepflvllgDaa
00501781   1/1  y.........................gvevvyvrqdealgtggavlaalelladgddpvlvllgDvPlit
00530951   1/1  glellnkmkaviLAGGlGtRLgp...slPKpllpvgngkpllehilerlkalqkkagikveiiivtsykt
00502661   1/1  .lgl........................dilivlqpgglgtagsvllalealgdldddpvlvldgDrpll
00503871   1/1  gdl...........................girvvlqpgglgtagavllalealgdgddlvlvldgDrpl
00464661   1/1  .........................glkviivlepeglgtadailaalkalgddpvlvllgDvplidpd.
00466591   1/1  klgievilrikylqg.......................dglgtadavllalkalgkdddpvlvllgDrpl
00503661   1/1  ............................dkvvvvvegglgradsvlnaleal.........dddivlvhd
00490571   1/1  ky.........................gaevvfrpaelagdgagtadsvlaaleale.d.......ddiv


                         +         -         -         -         -         *         -:210
query           GTGTLKQMVKAVEGTDIRGCIATQQVKREKTNSYGIVAKDNDNLIKAIVEKPAPEKAPSTNAVVGRYLLP
00513641   1/1  llgDhli.dvd.....lselleahresgalatllvvpvpledptgyGvieldedgrvlsfvEkpdletae
00406931   1/1  .....lrelleahrekgalvtvllvpve..dpsgygvveldedgrvlrfvEkpd..epgsnlanaGiyvf
00441681   1/1  ..dedlaelleahresgaavtvvpvp....dpsgygvvvlde.grvlsfvekp...dresllanagiyvf
00384271   1/1  vd.....laelleaareegalatvllvpve..dptgygvveldedgrvlsfvekpd..lagsnlansGiy
00468771   1/1  .....laelleahresgalatllvvpved..ptgygvveldedgrvlsfvEkpd..eprsnlanaGiyvf
00380051   1/1  ded.....ldelleahlesgadatvlv..vpvedpsgygvvvldedgrvlsfvekpdllaaqtpsnlant
00387431   1/1  d....lerllealaetg..atilvvpvedp..tgygvvvld.dgrvleivekpdllaeqtpsnlaniGiy
00477071   1/1  .......lleahle...sgalatvlvkdp..tgygvvvldedgrvlsfvekpd.....snlanagiyvfs
00473731   1/1  ..pd.ldelleahresgadvtvlvvpvedp..tgygvvevdedgrvlefvekpd..lpksnlantgiyvf
00384621   1/1  ....dldelleallesgadivvlvvevddpillalpgygvvvldedgrvlyfvekpipyrrqdlapsyli
00481371   1/1  ....pd.leelleahresgadvtvlvvpv..edptgygvvevdedgrvlsfvekpdlppsq..lanaGiy
00501951   1/1  pe....dldrllealresgadatllvvpvpdpepltgygygvvvldedgrvlrfvekpdafraelllyll
00388811   1/1  e....llerllealeehgalallav......pvgdygvvvldedgrvleivekpd.....lnlantGqyf
00447431   1/1  rplvspe....lldrllealeedgaavtlv........ppvygtikldedgrvveivekpd.....lnla
00501781   1/1  pe....lidrllealresgadaavlvvpve..dpegygvpnvvkvvldedgrvlgfvekpipltaerlll
00530951   1/1  aelikeylgdgsyfglk......................ityvvqgkeplgtagalllaldflgddpflv
00502661   1/1  spe....lldrlleaakesgaavtv.........ppgygtikld.dgrvleivekpd......llanqgp
00503871   1/1  vdpe....lldrlieaaaegg..avvlav......pvgygvvvvdedgrvveivekpd.....lnlantg
00464661   1/1  ...lidklleal..kgadatvlvvpvrdptg..ygvfkldllgkllsfvekpatdla.sllalaglyvll
00466591   1/1  idpe....didkliealkkngadavvlvvpvkdp..ngygvv.ldkdglvlafvekpfpltrlqdlpksy
00503661   1/1  gdrplvspelidrllealkeag....aailalpvkdtlkygditldrdglw................aaq
00490571   1/1  lvldadrpllspedidrllealresgadgailvvpvsdt...lkrgvvldedgrvlalvekplarartqd


                         -         -         -         +         -         -         -:280
query           NKIFRCLESTSEGAGGEIQLTDAIAKLLDQDEKILSYEFKGTRYDCGSKLGFLIANYEIALQHQELGHKF
00513641   1/1  eylalglllllsllllepksnlansGiyvfspevlldlleelap..ggelfltdilpal-----------
00406931   1/1  spevldlleellpsargelfltdvidylleegllkvyaypfdgywldvgtpedlleanallllllar---
00441681   1/1  spelldllle.....rgelyltdvlplllaag.kvyavpldgywldvgtpedlleaealllsrlarlg--
00384271   1/1  vfdaslldlleelapsafgeleltdvlyallekglrvvavlgdgfawldvgtpedllea-----------
00468771   1/1  spevldlleelkpsargelfltdvidlllaegllkvyaypldgywldvgtpedlleanalllsglaligl
00380051   1/1  Giyvfdpelldallellpsdgargelyltdvislllaaglkvlaveldgywldvgtpedlleaealllkr
00387431   1/1  vfspevldallelllkpgargeleltdllsllleaglkvlavlgdgfwldvgtpedlllaeallllrlae
00477071   1/1  pevfdllkelleellkpgargelyltdilaallekglkvvavlldgywldvgtpedllea----------
00473731   1/1  npgvlllllelllsalgeleltdilrallaaglkvyavlldgyewldvgtpedlleaeidlavrekrlgl
00384621   1/1  nggiyvfrpeillallellpgaleeiellealrlla.aggrvlayevdgewldvdtpedlllaeall---
00481371   1/1  vfrpdvldaleelapsalgeleltdiidllleeglkvaavlgdgfewldvgtpedlleaealllsrlvrl
00501951   1/1  nsgifleatsdlanagiyvfspevlealenldidtledlelaeillall.kggkvyavlldgye------
00388811   1/1  lspalldal...ealaggelyltdllslleaaglrvlavegdgewldigtpedlalaea-----------
00447431   1/1  ntGqyflsplllealea.....ggeiyltdllslleaaglkvlavegdglwidvgtped-----------
00501781   1/1  rrqdlpvsylinggiyafrpelllalle...gargeleltdvlellralaaggrvaave-----------
00530951   1/1  lPdGnGD.iltdld.....lsklldfhlesgadatlvvnvdnlvpvadpsryGvveldg-----------
00502661   1/1  ylfdaellleal......rgelyltddlallekaglkvavvegdgewldvgtpedlalae----------
00503871   1/1  qyflspllldal...ekaargeleltdilslllelglkvvvvpgdgfwldvgtpedlal-----------
00464661   1/1  vpglldll..kdidtpedlela------------------------------------------------
00466591   1/1  langgiyifdasvllk..................lralengkkvavvlgdglwldidtpe----------
00503661   1/1  tpqlfrlellleal......egeyyltddasllealglkvalvegdeenikittpeDla-----------
00490571   1/1  lfrlyllnggiyilk.daldealaleggkvvalvlgdernididtpeDl---------------------


                         -         *         -         -         -         -         +:350
query           KEYLQNR---------------------------------------------------------------
00513641   1/1  ----------------------------------------------------------------------
00406931   1/1  ----------------------------------------------------------------------
00441681   1/1  ----------------------------------------------------------------------
00384271   1/1  ----------------------------------------------------------------------
00468771   1/1  vl--------------------------------------------------------------------
00380051   1/1  lae-------------------------------------------------------------------
00387431   1/1  lgl-------------------------------------------------------------------
00477071   1/1  ----------------------------------------------------------------------
00473731   1/1  ----------------------------------------------------------------------
00384621   1/1  ----------------------------------------------------------------------
00481371   1/1  ----------------------------------------------------------------------
00501951   1/1  ----------------------------------------------------------------------
00388811   1/1  ----------------------------------------------------------------------
00447431   1/1  ----------------------------------------------------------------------
00501781   1/1  ----------------------------------------------------------------------
00530951   1/1  ----------------------------------------------------------------------
00502661   1/1  ----------------------------------------------------------------------
00503871   1/1  ----------------------------------------------------------------------
00464661   1/1  ----------------------------------------------------------------------
00466591   1/1  ----------------------------------------------------------------------
00503661   1/1  ----------------------------------------------------------------------
00490571   1/1  ----------------------------------------------------------------------