[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30777.1


[Show Plain Result]

## Summary of Sequence Search
   1::268
   2::267  1.1e-29 23.5% 0046519 00465191 1/1   minal nucleophile aminohydrolases (Ntn  
   2::166  7.7e-26 26.9% 0049601 00496011 1/1   minal nucleophile aminohydrolases (Ntn  
  23::171  4.8e-17 21.1% 0050948 00509481 1/1   minal nucleophile aminohydrolases (Ntn  
   1::157  5.5e-08 31.5% 0046214 00462141 1/1   minal nucleophile aminohydrolases (Ntn  
  42::171  3.1e-07 25.6% 0047031 00470311 1/1   minal nucleophile aminohydrolases (Ntn  
  51::150  7.5e-05 25.0% 0036865 00368651 1/1   minal nucleophile aminohydrolases (Ntn  
   1::268


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MCRWLMYHGDKIKMSDLLVDPENSLIHQSIHSSQGAVPVNGDGFGVGWYTSLHKEPGVYKDPLPAWNNQN
00465191   1/1  -CgivGivglk.dvlelllegllalehR...........GpdgaGiavydl.ggglrvfkdvglvadlan
00496011   1/1  -Cgilgivg......nvltllllgllrleyRg..gltglnyDgaGiagldg..kglrvykglglvadlfl
00509481   1/1  ----------------------CGivGivglkdvaellleglkalehRGpDsaGiavldggg..lllvrk
00462141   1/1  mlmcGivgilgksllvadlllemlkalehRGpdsagiavld.............................
00470311   1/1  -----------------------------------------CGivGivglkdvaellleglkalehRGpd
00368651   1/1  --------------------------------------------------slssrtivyKglglveqvfe


                         -         -         *         -         -         -         -:140
query           LISLAKHIKSRNFMAHVRASTIAPTSRVNCHPFTFKNHLFMHNGSIAGFDDIRQEIEQLVKPQYFKARFG
00465191   1/1  llslle.lkgnlgigHtRlathglpslenaqPflvdllgrlalvhNGeiynylelreel....lealgyi
00496011   1/1  ahrlpdlplkgnlglgHtRlatiglpslanaqPfvselpdgrlalvhNGeiynylelreelea.......
00509481   1/1  avglvsdlfllllleklkgnlgigHtRlathglsslanahpfvsggialvhNGeiynylelreele....
00462141   1/1  ............nlglghtRlstiglss..naqPfvsedgrlalvhnGeiynylelrkelek...gyif.
00470311   1/1  sagiavldg..ggllvlkgvglvsdlfelll.llplkgnvgigHtRlathglpslenaqPflsnslllgg
00368651   1/1  fyldllledlegslalgHtRysTntlpswenaqPf....ralaHNGeinnllglrnwleargalftsell


                         +         -         -         -         -         *         -:210
query           STDSEAIFLLAVSNGLENDPKLAIVKSIEQITKIQAKNGLKESIKASIAYSNGEISYSLKISTIGNEPSL
00465191   1/1  fvsdtDtEvilhlilelllellllplegldllealraalkrl..........egafalalld.dggplla
00496011   1/1  ...kgdsDtEvilhllellllegldl--------------------------------------------
00509481   1/1  .elgyifksdtDtEvilhllaelllegldll---------------------------------------
00462141   1/1  ..ksdsDtevilhllal-----------------------------------------------------
00470311   1/1  lalvhNGeiynylelreeleal...gy..if---------------------------------------
00368651   1/1  gddlekllPi------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           YYISYKDIIETLDLKKKNKFKNGFVVLSEPLVKSDSYSYVNNYTCIEIRQNEFKVEKL------------
00465191   1/1  ardrlgirPlvygll...........ltldgdgelvvASeplallalgfedvrelep-------------
00496011   1/1  ----------------------------------------------------------------------
00509481   1/1  ----------------------------------------------------------------------
00462141   1/1  ----------------------------------------------------------------------
00470311   1/1  ----------------------------------------------------------------------
00368651   1/1  ----------------------------------------------------------------------