[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30798.1


[Show Plain Result]

## Summary of Sequence Search
   1::268
  11::257    5e-39 29.7% 0049498 00494981 1/1   -like ATPase domain                     
 132::268  1.7e-26 33.1% 0051509 00515091 1/1   -like ATPase domain                     
 129::261  4.2e-26 32.6% 0051804 00518041 1/1   -like ATPase domain                     
   9::132  1.8e-25 33.3% 0050670 00506701 1/1   -like ATPase domain                     
  11::131  6.9e-25 35.4% 0050911 00509111 1/1   -like ATPase domain                     
 130::268  9.2e-25 32.1% 0051456 00514561 1/1   -like ATPase domain                     
  10::130  1.1e-24 31.9% 0052960 00529601 1/1   -like ATPase domain                     
 133::259  1.4e-24 31.7% 0052961 00529611 1/1   -like ATPase domain                     
 133::260  8.2e-24 29.7% 0053028 00530281 1/1   -like ATPase domain                     
 132::262  1.1e-23 31.5% 0051732 00517321 1/1   -like ATPase domain                     
 132::265  1.5e-23 31.7% 0050912 00509121 1/1   -like ATPase domain                     
   8::131  1.7e-23 30.8% 0051457 00514571 1/1   -like ATPase domain                     
   7::131  2.5e-23 31.1% 0051508 00515081 1/1   -like ATPase domain                     
   8::130  1.5e-22 32.5% 0053029 00530291 1/1   -like ATPase domain                     
  11::128  1.4e-21 33.3% 0051805 00518051 1/1   -like ATPase domain                     
 132::251    7e-20 34.4% 0050671 00506711 1/1   -like ATPase domain                     
  10::131  2.4e-19 32.8% 0051731 00517311 1/1   -like ATPase domain                     
 131::261  3.5e-16 22.9% 0049353 00493531 1/1   -like ATPase domain                     
  10::238    3e-14 22.8% 0047243 00472431 1/1   -like ATPase domain                     
 134::260  1.2e-12 23.1% 0052165 00521651 1/1   -like ATPase domain                     
   7::127  2.1e-11 24.5% 0051548 00515481 1/1   -like ATPase domain                     
 102::260    4e-10 17.9% 0038007 00380071 1/1   -like ATPase domain                     
   8::126  1.5e-09 19.3% 0052166 00521661 1/1   -like ATPase domain                     
   1::268


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKEIQIKNRTVVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSEVEGI
00494981   1/1  ----------gyvlgiDiGgtnirvalvdldgevlarvriptpnp....fdeildaiaelleea.gldil
00515091   1/1  ----------------------------------------------------------------------
00518041   1/1  ----------------------------------------------------------------------
00506701   1/1  --------mkyvlGidiGgtkikaalvdldgevlarariptpglaeqdpeavldaiaelirellaeagls
00509111   1/1  ----------yvlgidiggtkikaalvdldgeilarlriptp.....gpeavleaiaelikel...dilg
00514561   1/1  ----------------------------------------------------------------------
00529601   1/1  ---------myvlgidiggtkikvalvdldgeilarvriptp....adpealldaiaelidel...dilg
00529611   1/1  ----------------------------------------------------------------------
00530281   1/1  ----------------------------------------------------------------------
00517321   1/1  ----------------------------------------------------------------------
00509121   1/1  ----------------------------------------------------------------------
00514571   1/1  -------pdaayvlgidiggtkiklalvdldgeilarlriptpa...ldpeavleaiaelieellaelgl
00515081   1/1  ------pdaayvlgidiggtkiklalvdldgevlarlriptpap...dpeavldaiaelieellaelgld
00530291   1/1  -------Pdaayvlgidiggtkikvalvdldgevl..arvriptpadldpealldaiaelieellaelgl
00518051   1/1  ----------yvlgidiggtkiklalvdldgeilarlriptpas...dpeavldalaelidellaeagri
00506711   1/1  ----------------------------------------------------------------------
00517311   1/1  ---------alvlgidiggtkiklalvdldgeil..arlriptpadldpeavldaiaelidell.aelgl
00493531   1/1  ----------------------------------------------------------------------
00472431   1/1  ---------smlilGIDlGttntkaalvdedgeilaeasvppedalealleaikealeea.gisfddida
00521651   1/1  ----------------------------------------------------------------------
00515481   1/1  ------mmmkyllGiDgGgTktravlvdldgtvlararpgpgnveqgpeaaleaileairealakagldp
00380071   1/1  ----------------------------------------------------------------------
00521661   1/1  -------mmklylGiDgGgTktkavlvdedgkilarakagttnplllgleealeaiaeaveealekagld


                         -         -         *         -         -         -         -:140
query           GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGKQYENFVGIT
00494981   1/1  gigigvpgpvdddtgil...tnlp.wg.fdlkd.leealglpvvaleNDanaaalalllldedlealfga
00515091   1/1  -------------------------------------------------------------gldnflylt
00518041   1/1  ----------------------------------------------------------Agkgvdnllylt
00506701   1/1  grilgiGigvpglvdldtgvvllapnl.gwndvdlaelleellglpvlvenDanaaalaEal--------
00509111   1/1  iGigvpGpvdletgvvlyglitaanllgwrgvplkelLeealglpvvvenDanaaAlaEll---------
00514561   1/1  -----------------------------------------------------------g..ldnfvylt
00529601   1/1  iGigvpGpvdldtgvillapnlpgwngvplaelle.llglpvllenDanaaalaEllfGa----------
00529611   1/1  --------------------------------------------------------------ldnfvylt
00530281   1/1  --------------------------------------------------------------sdnlvylt
00517321   1/1  -------------------------------------------------------------gldnvvylt
00509121   1/1  -------------------------------------------------------------gldnvvylt
00514571   1/1  dlsrllgiGiavpGpvdletgvvlnapnlp.wrgvdlaelLeealglpvlvenDanaaala---------
00515081   1/1  lsrllgiGiavpGpvdldtgvvlsapnlpgwrgvdlaelLeealglpvvvenDanaaalaE---------
00530291   1/1  dlsrllgiGiavpgpvdldtgvvlnapnlg.wrgvdlaelLeealglpvvvenDanaaal----------
00518051   1/1  lgigigvpGpvdaetgvvllapnlg.wrgvplaelLeerlglpvllenDanaaalaEa------------
00506711   1/1  -------------------------------------------------------------glgnvlylt
00517311   1/1  iGiavpGpv..adgvvlllnapnlpgwrgvdlaelLeealglpvfvenDanaaalaE.lfg---------
00493531   1/1  ------------------------------------------------------------ledlnlivvh
00472431   1/1  iavtgqggglagldvvgl...........................vndplaaalaagllgageg....lv
00521651   1/1  ---------------------------------------------------------------edgivvi
00515481   1/1  sdiallaigiGlaGvvqreglvlldaallpla...............pvivwnDara-------------
00380071   1/1  -------------------------------elaylyaiPaelydevgvrrygfHglshkyvarraaell
00521661   1/1  lsldllavglglaGaid..........pllglilvpllkellellglpvlvenDan--------------


                         +         -         -         -         -         *         -:210
query           IGTGIGGGIINKGSLLKDSNCGAGEFGMLPYLDGILEDYCSGQFFIKKIGVEGVEILKRARNNDKDTINI
00494981   1/1  gkglddgvvlilglGtGigvaglvlngkllrgingeaGhighlpggdfdlalldclcgnpgclsleklas
00515091   1/1  lgtGiGgGivlngkllrlGanglA.EiGhlpvdpdgplcgcgnrgclEtyaSgpallrlyrellglglls
00518041   1/1  lgtGiGgGivlngkllrganglagEiGhlpvpllralelaldpdgplcgcgnrgclEtyaSgpallrlar
00506701   1/1  ----------------------------------------------------------------------
00509111   1/1  ----------------------------------------------------------------------
00514561   1/1  lgtGiGgGivingkllrGanglagEiGhllvdpdgllcgcgrrgclEtyasgpallrlarellglglesl
00529601   1/1  ----------------------------------------------------------------------
00529611   1/1  lgtGiGggivlngkllrganglagEiGhllvdprcgnrgcletlaSgpallrlyrallglegldaeelfe
00530281   1/1  lgtgiGgGivlngkllrGanglageiGhllvdpdgplccletlasgpallrraegldaeelfeaaragdp
00517321   1/1  lgtGiGggivlngkllrganglagEiGhlllppdgllcycgrrgcletlasgpallrlyrellgdldaee
00509121   1/1  lgtGiGgGivingkllrGa..lagEiGhllvplldpdgplclcgnrgvcletlasgpal........eei
00514571   1/1  ----------------------------------------------------------------------
00515081   1/1  ----------------------------------------------------------------------
00530291   1/1  ----------------------------------------------------------------------
00518051   1/1  ----------------------------------------------------------------------
00506711   1/1  lGtGiGggiildgkllrg.....gElGhlcgnrgclealasgpalvr...................alav
00517311   1/1  ----------------------------------------------------------------------
00493531   1/1  LGtGvsggailnGksvdtsmglpleglvmgtrsgdldpgcglylcletgasatelvrllnkksgllglsg
00472431   1/1  ldiGggttdvsivkdgklvvgalggdgelgggllddaiarllglgfpgaiellasglalvrlkgldlpfs
00521651   1/1  lGTGsgaggidpd....grlcrcGgwGhl......lgdegSgywigrralravlraldgrgpapalptal
00515481   1/1  ----------------------------------------------------------------------
00380071   1/1  gkgleelnlivahLGnGasvaaiknGksvdtsmGltpleGlvmgtRsGdldpgvllylllelglsleell
00521661   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           YKQFGKHLGVAIKSIMYTLDPEVIIIAGSIISAREFFEKAMWDEIKTFAFINQLKKLK------------
00494981   1/1  gpgllrllrllleklglegslldaeevfeaaragfdplalaildraa-----------------------
00515091   1/1  lldlegldaeeifeaaragdplaleildefaralaralanlinlldpeaivlgGglsr------------
00518041   1/1  alggelldaeeifeaaeagdplalealdefarylaralanlillldpeliv-------------------
00506701   1/1  ----------------------------------------------------------------------
00509111   1/1  ----------------------------------------------------------------------
00514561   1/1  lsglealdaeeifeaaragdplaleildeaadalaralanlinlldpeaivlgGglsr------------
00529601   1/1  ----------------------------------------------------------------------
00529611   1/1  aalagdplalealdrfarylaralanlvllldpeaivlgGgvsa.gdll---------------------
00530281   1/1  lalevldeaarylaralanlinlldpelivlgGgvsrlgdlllealreal--------------------
00517321   1/1  ifeaaragdplalevldefaralaralanlillldpeaivlgGglsrlgdll------------------
00509121   1/1  feaaragdplalevldeaarylaralanlinlldpelivlgGgvsna.ellldll---------------
00514571   1/1  ----------------------------------------------------------------------
00515081   1/1  ----------------------------------------------------------------------
00530291   1/1  ----------------------------------------------------------------------
00518051   1/1  ----------------------------------------------------------------------
00506711   1/1  ldefarylaralanlillldpelivlgGgvsaagdlllell-----------------------------
00517311   1/1  ----------------------------------------------------------------------
00493531   1/1  ssdarevleaaeegdelAklaldafayrlakyigslaavldgepdaivltG-------------------
00472431   1/1  glkitralfegleiadilaallealaea------------------------------------------
00521651   1/1  tealleylglsdlaellaflysappkaviAslaplvaeaaeegDplAlai--------------------
00515481   1/1  ----------------------------------------------------------------------
00380071   1/1  ellnkesGllglsglssdlrelleaaeegdelaklaldlfvyriakyiga--------------------
00521661   1/1  ----------------------------------------------------------------------