[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30829.1


[Show Plain Result]

## Summary of Sequence Search
   1::111
   1::104  3.2e-31 44.2% 0050251 00502511 1/1   omal protein S6                         
   1::97   1.7e-29 40.2% 0046201 00462011 1/1   omal protein S6                         
   1::111


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNIECPTES
00502511   1/1  lmrlYElvlilrpdlseeevkalveklkelltenlggvilkvedwGlrkLaYpikklrkGhYvlinfead
00462011   1/1  mrlYElvlilrpdlseeevkalleklkklltenggevlkvedwGlrkLaYeikklreGyYvllnfeadpe


                         -         -         *         -         -         -         -:140
query           LEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKEVI-----------------------------
00502511   1/1  peaikelerllrlnedvlRflivkldealeelsa------------------------------------
00462011   1/1  aiaelerllrlnedvlRflivkldeel-------------------------------------------