[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30912.1


[Show Plain Result]

## Summary of Sequence Search
   1::235
   1::232  4.6e-62 35.8% 0051568 00515681 1/1   )-binding Rossmann-fold domains         
   2::235  7.4e-61 35.8% 0049902 00499021 1/1   )-binding Rossmann-fold domains         
   1::236  3.7e-60 36.0% 0050365 00503651 1/1   )-binding Rossmann-fold domains         
   1::235  4.9e-59 35.8% 0046592 00465921 1/1   )-binding Rossmann-fold domains         
   2::235  1.1e-58 35.7% 0042131 00421311 1/1   )-binding Rossmann-fold domains         
   1::236    2e-58 36.2% 0050967 00509671 1/1   )-binding Rossmann-fold domains         
   3::235  2.8e-58 36.4% 0048361 00483611 1/1   )-binding Rossmann-fold domains         
   1::235  1.1e-57 36.1% 0045076 00450761 1/1   )-binding Rossmann-fold domains         
   1::236  1.8e-57 36.1% 0047124 00471241 1/1   )-binding Rossmann-fold domains         
   1::232    1e-56 36.7% 0037662 00376621 1/1   )-binding Rossmann-fold domains         
   2::235  1.3e-56 39.2% 0046483 00464831 1/1   )-binding Rossmann-fold domains         
   1::232  1.4e-56 34.5% 0051511 00515111 1/1   )-binding Rossmann-fold domains         
   1::235  2.3e-55 34.9% 0038342 00383421 1/1   )-binding Rossmann-fold domains         
   1::236  2.4e-55 36.9% 0053286 00532861 1/1   )-binding Rossmann-fold domains         
   1::233  2.8e-55 36.1% 0050955 00509551 1/1   )-binding Rossmann-fold domains         
   2::235  2.8e-55 37.5% 0047681 00476811 1/1   )-binding Rossmann-fold domains         
   1::235  4.8e-55 35.9% 0051763 00517631 1/1   )-binding Rossmann-fold domains         
   1::237    5e-55 36.2% 0052529 00525291 1/1   )-binding Rossmann-fold domains         
   1::236  9.5e-55 36.9% 0050776 00507761 1/1   )-binding Rossmann-fold domains         
   1::236  1.1e-54 35.7% 0043703 00437031 1/1   )-binding Rossmann-fold domains         
   1::234  1.2e-54 35.5% 0052368 00523681 1/1   )-binding Rossmann-fold domains         
   1::232  1.3e-54 36.8% 0038042 00380421 1/1   )-binding Rossmann-fold domains         
   1::237  1.3e-54 36.9% 0049943 00499431 1/1   )-binding Rossmann-fold domains         
   1::236  1.3e-54 36.8% 0053266 00532661 1/1   )-binding Rossmann-fold domains         
   1::236  2.4e-54 33.9% 0051440 00514401 1/1   )-binding Rossmann-fold domains         
   1::236  3.8e-54 34.9% 0050237 00502371 1/1   )-binding Rossmann-fold domains         
   3::236  4.8e-54 36.4% 0046801 00468011 1/1   )-binding Rossmann-fold domains         
   1::236  6.8e-54 33.9% 0050383 00503831 1/1   )-binding Rossmann-fold domains         
   1::236  9.8e-54 36.3% 0051006 00510061 1/1   )-binding Rossmann-fold domains         
   1::234    1e-53 35.3% 0039438 00394381 1/1   )-binding Rossmann-fold domains         
   1::236  2.2e-53 36.8% 0048949 00489491 1/1   )-binding Rossmann-fold domains         
   1::235  3.1e-53 35.2% 0052988 00529881 1/1   )-binding Rossmann-fold domains         
   1::232  6.5e-53 34.9% 0035018 00350181 1/1   )-binding Rossmann-fold domains         
   1::236  1.1e-52 37.3% 0051702 00517021 1/1   )-binding Rossmann-fold domains         
   4::232  1.4e-52 35.8% 0042505 00425051 1/1   )-binding Rossmann-fold domains         
   1::232  1.5e-52 36.2% 0051542 00515421 1/1   )-binding Rossmann-fold domains         
   3::235  1.7e-52 36.1% 0036922 00369221 1/1   )-binding Rossmann-fold domains         
   1::235  2.6e-52 34.5% 0051965 00519651 1/1   )-binding Rossmann-fold domains         
   1::232  2.7e-52 35.8% 0045153 00451531 1/1   )-binding Rossmann-fold domains         
   3::236  2.9e-52 36.3% 0038068 00380681 1/1   )-binding Rossmann-fold domains         
   1::237    3e-52 36.4% 0049942 00499421 1/1   )-binding Rossmann-fold domains         
   3::232  3.1e-52 36.6% 0049845 00498451 1/1   )-binding Rossmann-fold domains         
   1::237  3.3e-52 35.3% 0036806 00368061 1/1   )-binding Rossmann-fold domains         
   1::236  5.5e-52 35.3% 0052085 00520851 1/1   )-binding Rossmann-fold domains         
   1::235  7.7e-52 36.2% 0050022 00500221 1/1   )-binding Rossmann-fold domains         
   1::232    1e-51 37.6% 0051093 00510931 1/1   )-binding Rossmann-fold domains         
   1::237  3.7e-51 35.0% 0047470 00474701 1/1   )-binding Rossmann-fold domains         
   1::236  4.2e-51 35.9% 0041610 00416101 1/1   )-binding Rossmann-fold domains         
   1::231    6e-51 34.6% 0041757 00417571 1/1   )-binding Rossmann-fold domains         
   1::232  6.1e-51 36.4% 0038770 00387701 1/1   )-binding Rossmann-fold domains         
   1::233  8.7e-51 34.5% 0038814 00388141 1/1   )-binding Rossmann-fold domains         
   1::237  8.7e-51 35.6% 0051279 00512791 1/1   )-binding Rossmann-fold domains         
   1::232  1.1e-50 36.6% 0041366 00413661 1/1   )-binding Rossmann-fold domains         
   1::232  1.5e-50 37.4% 0035471 00354711 1/1   )-binding Rossmann-fold domains         
   1::232  1.6e-50 37.1% 0040910 00409101 1/1   )-binding Rossmann-fold domains         
   2::232  1.8e-50 35.8% 0048614 00486141 1/1   )-binding Rossmann-fold domains         
   1::236    2e-50 35.8% 0036194 00361941 1/1   )-binding Rossmann-fold domains         
   1::232  3.1e-50 36.6% 0041692 00416921 1/1   )-binding Rossmann-fold domains         
   1::232  5.3e-50 35.4% 0038545 00385451 1/1   )-binding Rossmann-fold domains         
   3::235  8.1e-50 37.6% 0051955 00519551 1/1   )-binding Rossmann-fold domains         
   3::235  8.7e-50 37.2% 0048243 00482431 1/1   )-binding Rossmann-fold domains         
   1::236  9.7e-50 34.5% 0039871 00398711 1/1   )-binding Rossmann-fold domains         
   1::236  1.9e-49 36.2% 0051355 00513551 1/1   )-binding Rossmann-fold domains         
   1::236  2.9e-49 36.2% 0042429 00424291 1/1   )-binding Rossmann-fold domains         
   2::237  4.4e-49 38.0% 0050655 00506551 1/1   )-binding Rossmann-fold domains         
   1::235  6.7e-49 34.7% 0052873 00528731 1/1   )-binding Rossmann-fold domains         
   2::232  6.8e-48 37.6% 0038559 00385591 1/1   )-binding Rossmann-fold domains         
   1::229  6.9e-48 34.4% 0043678 00436781 1/1   )-binding Rossmann-fold domains         
   1::235  7.7e-48 35.9% 0051260 00512601 1/1   )-binding Rossmann-fold domains         
   1::236  1.8e-47 37.6% 0048286 00482861 1/1   )-binding Rossmann-fold domains         
   1::232  6.6e-47 35.0% 0035305 00353051 1/1   )-binding Rossmann-fold domains         
   1::232  5.1e-44 31.6% 0051203 00512031 1/1   )-binding Rossmann-fold domains         
   1::233  4.7e-42 33.5% 0052744 00527441 1/1   )-binding Rossmann-fold domains         
   1::232  1.3e-40 35.5% 0051109 00511091 1/1   )-binding Rossmann-fold domains         
   1::234  1.7e-32 27.6% 0050721 00507211 1/1   )-binding Rossmann-fold domains         
   4::235    6e-32 26.9% 0049026 00490261 1/1   )-binding Rossmann-fold domains         
   4::232  9.6e-32 28.2% 0049864 00498641 1/1   )-binding Rossmann-fold domains         
   3::235  4.9e-31 27.8% 0048293 00482931 1/1   )-binding Rossmann-fold domains         
   4::235  2.2e-30 28.2% 0046897 00468971 1/1   )-binding Rossmann-fold domains         
   3::235  4.1e-30 26.7% 0046034 00460341 1/1   )-binding Rossmann-fold domains         
   1::235  2.2e-29 27.3% 0049357 00493571 1/1   )-binding Rossmann-fold domains         
   4::235  2.1e-28 27.9% 0049519 00495191 1/1   )-binding Rossmann-fold domains         
   1::232  1.1e-27 28.1% 0051183 00511831 1/1   )-binding Rossmann-fold domains         
   2::188  2.4e-27 32.1% 0049428 00494281 1/1   )-binding Rossmann-fold domains         
   1::173  2.6e-27 30.6% 0048035 00480351 1/1   )-binding Rossmann-fold domains         
   1::235  3.6e-27 27.1% 0053287 00532871 1/1   )-binding Rossmann-fold domains         
   4::235  4.6e-27 26.7% 0049117 00491171 1/1   )-binding Rossmann-fold domains         
   2::232    8e-25 28.0% 0051491 00514911 1/1   )-binding Rossmann-fold domains         
   4::232  8.4e-25 26.3% 0043337 00433371 1/1   )-binding Rossmann-fold domains         
   1::232    9e-25 28.8% 0046574 00465741 1/1   )-binding Rossmann-fold domains         
   5::232  1.2e-23 24.5% 0037128 00371281 1/1   )-binding Rossmann-fold domains         
   4::232  2.8e-23 24.5% 0046291 00462911 1/1   )-binding Rossmann-fold domains         
   1::232    1e-22 25.5% 0040043 00400431 1/1   )-binding Rossmann-fold domains         
   4::232  2.4e-22 25.9% 0041999 00419991 1/1   )-binding Rossmann-fold domains         
   1::233  2.9e-22 26.6% 0046472 00464721 1/1   )-binding Rossmann-fold domains         
   1::232  4.6e-20 24.1% 0052722 00527221 1/1   )-binding Rossmann-fold domains         
   1::143  9.5e-20 28.2% 0046529 00465291 1/1   )-binding Rossmann-fold domains         
   1::232  3.5e-19 24.8% 0051991 00519911 1/1   )-binding Rossmann-fold domains         
   1::232  8.4e-19 25.0% 0038324 00383241 1/1   )-binding Rossmann-fold domains         
   1::232  1.2e-18 25.9% 0043041 00430411 1/1   )-binding Rossmann-fold domains         
   2::184  1.8e-17 29.5% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
   4::173  4.5e-17 27.2% 0051925 00519251 1/1   )-binding Rossmann-fold domains         
   4::167  1.4e-16 29.3% 0048516 00485161 1/1   )-binding Rossmann-fold domains         
   1::231  1.4e-15 23.8% 0043042 00430421 1/1   )-binding Rossmann-fold domains         
   4::170  1.8e-15 29.6% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
   1::143  2.9e-14 24.6% 0047965 00479651 1/1   )-binding Rossmann-fold domains         
   4::149  3.8e-13 25.2% 0038784 00387841 1/1   )-binding Rossmann-fold domains         
   1::235  6.9e-13 24.6% 0052116 00521161 1/1   )-binding Rossmann-fold domains         
   2::149  6.3e-11 29.9% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
   1::158    1e-10 24.1% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
   3::157    2e-09 25.2% 0048414 00484141 1/1   )-binding Rossmann-fold domains         
   1::139  3.4e-09 22.4% 0034872 00348721 1/1   )-binding Rossmann-fold domains         
   1::102  1.8e-08 24.5% 0035290 00352901 1/1   )-binding Rossmann-fold domains         
   2::232  4.6e-08 20.4% 0051696 00516961 1/1   )-binding Rossmann-fold domains         
   1::233  8.8e-08 21.1% 0047178 00471781 1/1   )-binding Rossmann-fold domains         
   1::133  4.4e-07 26.1% 0049198 00491981 1/1   )-binding Rossmann-fold domains         
   1::155  5.1e-07 24.6% 0035477 00354771 1/1   )-binding Rossmann-fold domains         
   1::133  1.7e-06 25.4% 0051996 00519961 1/1   )-binding Rossmann-fold domains         
   1::126    1e-05 23.3% 0048455 00484551 1/1   )-binding Rossmann-fold domains         
   3::106  0.00011 25.0% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
   1::235


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNRIVLITGATKRIGLATSLYLNNQGWQVIGIARSYIDNFPGELFLCDLANEEQTASTLIQINEIHGCP
00515681   1/1  mdlkgkvalvTGassgiGlaiAralaaaGarVvltdrneekleelaaelealggrvlavalDvtdeesve
00499021   1/1  -kgkvalvtGasnesgIGraiAlalaeeGakVvltdrneealeelaaelealldeslllslelllelekl
00503651   1/1  slkgkvalvtGassgiGlaiAralaeeGakVvltdrneekleelaaelealggkvlavalDvtdeesvea
00465921   1/1  mlldlkgkvalvtGaanssgiGraiAralaaeGarVvltdrneealeelaaeleaalpssllleleelle
00421311   1/1  -kgkvalvTGassgiGraiAralaaeGarVvltdrnseekleelaaeleallggralavalDvtdealae
00509671   1/1  dlkgkvalvTGassgiGlaiAralaaeGarVvltdrneekleelaaelealglpsgrvlavalDvtdees
00483611   1/1  --GkvalvtGasnesgiGraiAlalaeeGakVvitdrneealeelaaeleallseellleleelleleel
00450761   1/1  llvlllllllllslkgkvalvTGassgiGraiaralaaaGarVvlldrsseekleelaaelealgg...r
00471241   1/1  llmllslkgkvalvTGassGiGlaiAralaaaGarVvltdrseekleelaaeleallggrvlavalDvtd
00376621   1/1  llllmllslkgkvalvTGassgiGraiAralaaaGarVvltdrneekleelaaelealggrvlavalDvt
00464831   1/1  -sgkvalvTGassGiGlaiAralaaeGakVvlltdrneekleelaeeleallggkvlavalDvtdllell
00515111   1/1  LkgkvalvTGAssGiGraiAralaalleegarVvlvarneekleelaaeleallpggrvlavalDvtdee
00383421   1/1  pslslkgkvalvTGasgGiGralaralaarGarVvlldrsglssllllsaekleelaaelggrvlavalD
00532861   1/1  sdmldlkgkvalvtGassgiGlaiAralaeeGakVvltdrne.ekleelaaelealggkvlavalDvtde
00509551   1/1  lllmlldlkgkvalvTGassgiGlaiAralaaaGarVvlldrneekleelaaeleallpggrvlavalDv
00476811   1/1  -kgkvalvTGassGiGlaiAralaaaGarlllVvltdrneekleelaaelrallpsggrvlavalDvtde
00517631   1/1  mldlkgkvalvtGassgiGlaiaralaaaGarVvlldrneekleelaaegrvlavalDvtdeesvealv.
00525291   1/1  gdlsgkvalvtGassgiGlaiAralaaeGarVvltdrneleelaaelealggrvlavalDvtdeesveal
00507761   1/1  mlkgkvalvTGassgiGlaiAralaaeGarVvltdlrneekleelaaellealggrvlavalDvtdeesv
00437031   1/1  mdlkgkvalvtGassGiGraiAralaaeGarVvltdrneekleelaaelrallplggrvlavalDvtdee
00523681   1/1  dllkgkvalvtGassgiGlaiaralaeeGakVvltdrneeleelaeelkvlavalDvtdeesvealveei
00380421   1/1  mmlslkgkvalvTGassGiGlaiaralaaaGarVvlldrneekleelaaeleallggrvlavalDvtdee
00499431   1/1  lmlldlkgkvalvtGAagssgiGlaiAralaeeGakVvltdrne.ekleelaeeleelgkvlavalDvtd
00532661   1/1  gslkgkvalvtGAaGssgiGlaiAralaeeGakVvltdrneekleelaellalgg..kvlavalDvtdee
00514401   1/1  gsslldmldlkgkvalvTGasggiGraiAralaaaGarVvlldrneekleelaaeleaelplllggrvla
00502371   1/1  mdlkgkvalvtGassgiGlaiAralaaaGarVvltdrnaekleelaaellealggrvlavalDvtdeesv
00468011   1/1  --gkvalvTGassgiGraiaralaaaGarVvlldrneek......vqlDvtdeesvealveavleefggr
00503831   1/1  lllllllllllllldlllslldlkgkvalvTGasgGiGraiAralaaaGarVvlldrneekleelaaele
00510061   1/1  mslkgkvalvTGassgiGlaiAralaaeGarVvltdrneekleelaaelealglpsgrvlavalDvtdee
00394381   1/1  mmslkgkvalvTGassgiGraiaralaaaGarVvltdrsgeekleelaaelealggrvlavalDvtdees
00489491   1/1  gllkgkvalvtGAagssgiGlaiAralaeeGakVvltdrn..ekleelaeeleaaggkvlavalDvtdee
00529881   1/1  llslkgkvalvtGasselgiGlaiAralaaeGarVvltdrneealeelaaeleggralavalDvtdeesv
00350181   1/1  mmdlkgkvalvTGassgiGlaiaralaaaGarVvlldrneekleelaaelralggrvlavalDvtdeesv
00517021   1/1  ldlkgkvalvtGassgiGlaiAralaaaGarVvlldrseekleelaaelggrvlavalDvtdeesvealv
00425051   1/1  ---kvalvTGassgiGraiAlalaaeGarVvltdrneealeelaggkalavalDvtdeesvealveaave
00515421   1/1  mmldlkgkvalvTGassGiGraiAralaarGarVvladrseelaeleagleklealaeelggrvlavalD
00369221   1/1  --gkvalvTGassgiGlaiAralaaaGarVvlldrsgaekleelaaelealggrvlavalDvtdeesvea
00519651   1/1  smdlkgkvalvTGassgiGlaiAralaaaGarVvltdrneekleelaaeleaggrvlavqlDvtdeesve
00451531   1/1  psllslkgkvalvTGassgiGlaiAralaaaGarVvltdrneekleelaaelealggrvlavalDvtdee
00380681   1/1  --gkvalvTGasggiGlaiaralaaeGarVvlldrneekleelaaelealggrvlavalDvtdeesvaal
00499421   1/1  ldlkgkvalvtGassgiGlaiaralaaaGarVvlldrseekleelaaelrvlavalDvtdeesvealvaa
00498451   1/1  --gkvalvTGassgiGralaralaarGarVvlldrsee.ggrvlavaaDvtdeesvealvaaale.fgrl
00368061   1/1  dlkgkvalvTGassgiGlaiAralaaaGarVvlldrne.ekleelaaelggrvlavalDvtdeesvealv
00520851   1/1  llsllsllkgkvalvtGassgiGlaiAralaaaGarVvltdrsaekleelaaelealggrvlavalDvtd
00500221   1/1  lllslkgkvalvTGassgiGlaiAralaaeGarVvlldrseealervlavalDvtdeesvaalvaavlee
00510931   1/1  llllmlldlkgkvalvTGassGiGraiAralaaaGarVvltarneekleelaaelralggd..rvlaval
00474701   1/1  dlkgkvalvtGassgiGlaiAralaaeGarVvltdrneekleelaaelealggkarvlavalDvtdeesv
00416101   1/1  mmslkgkvalvTGassgiGlaiAralaaeGarVvltdrneekleelaaeleaggrvlavalDvtdeesve
00417571   1/1  mmdlkgkvalvTGAssGiGraiAralaalleeGarvvltarneekleelaaeleallpggrvlavalDvt
00387701   1/1  mmdlkgkvalvTGasggiGlaiaralaaeGarVvlldrneekleelaaelggrvlavalDvtdeesveal
00388141   1/1  ldlkgkvalvTGassgiGraiaralaarGarVvlldrse.ekleelaaelggrvlavalDvtdeesvaal
00512791   1/1  lldlkgkvalvTGassgiGlaiAralaaaGarVvlldrneekleelaaelg..rvlavalDvtdeesvea
00413661   1/1  mmdlkgkvalvtGassgiGlaiaralaaeGarVvlldrneekleelaaelggrvlavalDvtdeesveal
00354711   1/1  MslkgkvvlvTGasggiGralaralaaaGarVvlldrseekleelaaelggrvlavalDvtdeesveaav
00409101   1/1  mmdlkgkvalvTGassgIGlaiaralaaeGarvvlldrneekleelaaelealpggrvlavalDvtdele
00486141   1/1  -kgkvvlvtGgsggiGsalaralaaeGakvvlvdrseealaegggalavaaDvtdeeavealveaaveaf
00361941   1/1  mdlkgkvalvtGasggiGraiaralaaaGarVvlldrneekleelaaelg..rvlavvlDvtdeesveaa
00416921   1/1  dlkgkvalvtGassgiGraiaralaaeGarVvltarneekleggralavvlDvtde......veaaleaf
00385451   1/1  ldlkgkvalvTGasggiGlaiAralaaaGarVvlldrseekleelaaelggrvlavalDvtdeesvealv
00519551   1/1  --kkvalvtGassgiGlaiAralaeeGarlllleeeVvltdrneekleelaaelealggkvlavalDvtd
00482431   1/1  --lpvalvTGassGiGlaiAralaaaGarVvltdrlneekleelaaelralpggrvlavalDvtdeesvl
00398711   1/1  mdlkgkvalvTGassgiGraiaralaaaGarVvlldrne.ekleelaaelggrvlavalDvtdeesveal
00513551   1/1  lkgkvalvTGasggiGlaiaralaeeGdlakVvlldrneekleelaaelggrvlfvqlDvtdeesvealv
00424291   1/1  mmlslkgkvvlvtGasggiGralaralaaaGarVvlldrseekleelaaelg..rvlavvlDvtdeesve
00506551   1/1  -sGmkvalvTGassgiGlaiaralaealGakVvltdrneekleelaaelealggrvlfvalDvtdeesve
00528731   1/1  lkgkvalvTGassgiGlaiaralaaeGarVvlldrneekleelaaeleallpggrvlavalDvtdeesve
00385591   1/1  -egkvvLVtGgsggiGraiaralaaaGarVvvvdrseealgggvlavaaDvtdeeavaalvaaavellef
00436781   1/1  mdlkgkvalvTGassgiGlaiAralaaaGarVvlldrse.ekleelaaelggrvlavalDvtdeesveal
00512601   1/1  sdmslkgkvalvTGasggiGlalAralaarGarVvlldrseekleelaaelealggrvlvvalDvtdees
00482861   1/1  mlkgkvvlvTGassGiGlalaralaarGasrVvlldrneekleelaaelealggrvlfvqlDvtdeesve
00353051   1/1  mdlkgkvalvTGassGIGlaiAralaarGarvvlldrneekleelaaelralpggrvlavalDvtdeles
00512031   1/1  dslsllslkgkvalvTGassGiGraiAralaeeGarVvltdrneekleelaaelealgggkvlavalDvt
00527441   1/1  amdlgllsgkvvlvTGasggiGralaralaarGarvVvlldrsglleekleelaaelealggrvlfvaaD
00511091   1/1  sslsllldmlslkgkvalvTGasggiGralaralaarGarVvlldrseekleelaaelealgggrvlvva
00507211   1/1  ldmmslmgktvlvTGatGgiGsalaraLlarGaeVvlldrspekleelaaelealg.gvefvqgDltdpe
00490261   1/1  ---ktvlvTGatGgiGsalaraLlarGaeVvaldrspeklealaaeleallpllllfellglldellggr
00498641   1/1  ---krvLvTGgtGfiGsalaraLlerGaevvvldrseekleelleeleallggrvefvegDltdpealea
00482931   1/1  --nktvlvTGatGgiGsalaraLlarGaeVvlldrlssgaseekleelaaelraaggpgvefvqgDltdp
00468971   1/1  ---ktvlvTGatGgiGsalaraLlarpGaeVvaldrlsspeklealaallgalgvefvqgDltdpeslaa
00460341   1/1  --gktvlvTGatGgiGsalaraLlarpGaeVvaldrltsagspeklealaaelgvefvqgDltdpeslaa
00493571   1/1  llsllsslldllslkgktvlvTGatGgiGsalaraLlarGaeVvlldrspekleelaaelealggslllg
00495191   1/1  ---rktvlvTGatGgiGsalaraLlarGaeVvlldrlssglspekleellaellealgggvefvqgDltd
00511831   1/1  llllmmmslegktvLVTGAtGfiGsalvrrLlerGyeVvaldrspekleelaallealggdpgvelvvgD
00494281   1/1  -emktvlitGAnRGiGlelvkqllelakrgllviataRdpekaeeleelaaegsnlvilqldvtdeesie
00480351   1/1  gllldtallvllllllllldlkgkvalVtGasggiGlaiAralaaaGarVvladrne.eklealaaelga
00532871   1/1  lsgktvlVtGAtGgiGsalvrrLleagdvaevvalvrspekleelgg..gvevvvgDltdpdslaaala.
00491171   1/1  ---ktvlvTGatGgiGsalaraLlallllslaGaevvaldrspseealealaellalggvefvqgDltdp
00514911   1/1  -S.KtvlvTGatGgiGsalaraLlerGaeVvlldrspekleellaeleallgggvefvqgDltdpeslaa
00433371   1/1  ---ktvLVTGatGfiGsalaraLlerGyrVvaldrdpekleellaelealgggvefvegDltdpeslaaa
00465741   1/1  M.gktvlvTGatGgiGsalaraLlarGaeVvlldrspsslllllekleelaaelealgggvefvqgDltd
00371281   1/1  ----kvlVTGgaGfiGsalvraLlerGyeevvvldrlesgaklgpgvefvegDltdpesleaaleev.ek
00462911   1/1  ---skkvLvTGatGfiGsalvrrLlerGyeVialdrlssgsneekleellkelellgpgvefvkgDltdp
00400431   1/1  M.gkkvLvTGgtGfiGsalvraLlerGaevvvldrdpegaaellallealggprvefvagDltdpealea
00419991   1/1  ---kkvLvTGgtGfiGshlaraLlerGaevvvldrlsegaeellaelealgprvefvkgDltdpealaal
00464721   1/1  M.gktvlvtGatGfiGsalaraLlarGaveVvaldrspe..........Dltdpeslaaalagv.....r
00527221   1/1  llllkillslkgkkvlvtGAtGgiGralvkellargavskvialvRrpekleelaaegvevvvgDltdpe
00465291   1/1  PctplgvllllellgillllllmmlrlkgkvalVtGassgiGralAllLareGatVvvvdrneekleela
00519911   1/1  lllllllimmmlkgkkvlvtGAtGgiGralvkeLlergavskVtalvRrpekleelaae.gvevvvgDlt
00383241   1/1  M.gkrvLvTGgtGfiGshlvraLlerpGhevvvldrlpsgadallellalltlllslleklllllellgp
00430411   1/1  MsgkkvlvtGAtGfiGshlaraLleaGhevvalvRspekaalalalelleelaapgvevvegDltdpesl
00367851   1/1  -kgkkvlviGa.GgiGralaraLaeaGaevtvadrslekaealaaelggveavelDvtdeasldaal...
00519251   1/1  ---kkkilvtGatGfiGsalaraLlergyevialdrspekleellkllvefvkgDltdpesleealkg..
00485161   1/1  ---lsleeaAalplagltaylallllldlagllpgktvlvtGAaggiGsaaaqllaalGarViavdrsee
00430421   1/1  MkgmkvlvtGgtGfiGshlvraLleaGhevvvlvRnpskgkaaklelleellglgvevvegDltdpesla
00481861   1/1  ---kkvlvtGAsGgiGsalalllaargaevvlldrspeklegvaldlsdlgvevvvadltdpesla....
00479651   1/1  GkplvlggslgrseatgygvvysllaalkrllmglslegkvvlVtGaG.giGraiarrlaaeGakVvvtd
00387841   1/1  ---kkvlvtGAsGgiGsalalllakegaevvlvdrdeekalealagelldlgg.galvlvadvtdleave
00521161   1/1  MslllllllllmlkgmkilVTGaaGfiGshlvrrLlerGyevvaldrspekleelld.pgvefvegDltd
00496861   1/1  -AasilllgltsylallevlkikegkkVlvtGAtGgiGlavvrlllkrGykViaidrseekleklkelga
00421801   1/1  DgigavsllkrllvdlpgkkvlvlGaG.giGralalalaaagaevvvvnrtlekaeelaeelga...qgd
00484141   1/1  --gktvliiGa.GgvGlaiaqalaalGakkVvlvdrd....eekaqalveqlkelgskikvkavsldvgd
00348721   1/1  fhpinvgdlvtgllfdnllpctpsgvlellkatgidlaGkvavVtGasrgiGraiallLaaagatVtvcd
00352901   1/1  fgalnlgrlllgllglvpctplgilellerlgidlsgkvalVtGasggiGraiallLaraGatVtvtdrn
00516961   1/1  -kgkrvlvtGAtGfiGshlvrrLlaeghvsevvalvrrpskllpgvevvvgDltdp.........laeal
00471781   1/1  mmmmkvlvtGAtGfiGsalvrelleagheVtalvRdp.sklaallglgvevvvgDltdpaslaaala...
00491981   1/1  lnpsemkgkrvlvtGgtGfiGsnlaelLlergyevvgldrsepglnslldllllaeniaf..vkgDlsdk
00354771   1/1  MlkgmkvlVtGAaGgiGsalalrlaarglagldllvevvlldrsealealegvaldlsd..galavlldl
00519961   1/1  Mk...vLvtGatGfiGshlvrrLlerghleVvgldrls.sgleellelpgvefvegDltdpealeealak
00484551   1/1  DgiGfvellkrlgvdlkgktvlitGAG.gagraialalaklg.nvvianrtlekaealaeelgelgg.av
00502281   1/1  --mmkvlitGAtGfiGselvrlLlehgdhevtaldrrtsagkllnepgvevvegdltdpd.......dle


                         -         -         *         -         -         -         -:140
query           DAIINNVGIAIPEPLGKISISALNDVYNLNVRSAVQVSQFFIEKMKLKEQCKIVNIASRAIFGVKNRTSY
00515681   1/1  alveavleefgrldilvnnaGillplgplldlsledfervldvnllgtflltraalplmrkrgggrivni
00499021   1/1  lellaallelsdleggkalavaaDvtdeesvealvdaivekfgrldiLvnnagiagellgplldlsledw
00503651   1/1  lveeileefgrldilvnnagillpgplldlsledwervldvnllgvflltkaalplllmrkrgggrivni
00465921   1/1  leelleleaaleeleeleggralavaaDvtdeesvealvaaaveefgrldiLvnnagiallllgplldls
00421311   1/1  eleelelllllllesvealveaalerfgrldilvnnAgialvgallglllllllllkplldlsledwdrv
00509671   1/1  vealveevleefgrldilvnnAgialpgpgllldlsledfervldvnllgtflltraalplmlkrg.gri
00483611   1/1  leleaaleeledleggkalavaaDvtdeesvealvdaaverfgrldiLvnnagialllggplldlsledw
00450761   1/1  vlavalDvtdeesvealveavleefgrldilvnnAgillpgpleelsledfervldvnllgtflltraal
00471241   1/1  eesvealveavleefgrldilvnnAgillpgplleltledfervldvnllgvflltraalplmrkrglgg
00376621   1/1  deesvealveaileefgrldilvnnagillp.pllelsledfervldvnllgvflltraalplmrkrggg
00464831   1/1  eleleelleleleesvealveeileefgrldilvnnAGialpgpllllkslllsellgslldlsledwer
00515111   1/1  svealveavlellleefgrldilvnnAGillplllgplleltledwdrvldvnllgvflltraalplmrk
00383421   1/1  vtdeesvealveaaleefgrldilvnnAgilldgplleltledwervldvnllgtflltraalplmrkrg
00532861   1/1  esvealveeileefggrldilvnnagilllgplldlsledwervldvnllgvflltkaalplmrkrgggr
00509551   1/1  tdeesvaalvaavleefgrldilvnnAgillpgpllelsledwervldvnllgtflltraalplmrkrgl
00476811   1/1  esvealveav.e.fgrldiLvnnAGialpgpleelsledwervldvNllgtflltraalplmrkrgggri
00517631   1/1  ..ee.fgrldilvnnagillvgplldlsledfervldvnllgtflltraalpllrkrgggrivnisSvag
00525291   1/1  veavleefgrldilvnnagillpgplldlsledfervldvnllgvflltraalpllrkrgggrivnisSv
00507761   1/1  ealveevleefgrldilvnnagialpgplldlsledfervldvnllgtflltraalplmrkrgggrivni
00437031   1/1  svealveavleefgrldilvnnagillpllllgplldlsledfervldvnllgvflltraalpllrkrg.
00523681   1/1  leefgrldilvnnagilllgplldlsledwervldvnllgvflltkaalplmrkrgggrivnisSvagll
00380421   1/1  svealveaaleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalplmrkrglggri
00499431   1/1  eesvealveeileefgrldilvnnaGiaglslllgplldlsledwervldvnllgvflltkaalplm..r
00532661   1/1  svealveeileefgrldilvnnaGiagklellgplldlsledwervldvnllgtflltkaalplm..rgg
00514401   1/1  valDvtdeesvealveeileefgrldilvnnAgilavgpledlsledfervldvNvlgtflltraalpll
00502371   1/1  ealveavleefgrldilvnnagillpgplldlsledfervldvnllgvflltraalpllrkrgggrivni
00468011   1/1  ldilvnnAGialpgpll.......ervldvNllgtflltraalpllrkrgggrivnisSlavygalldlp
00503831   1/1  allggrvlavalDvtdeesvealveeileefgrldilvnnAgilavgpledlsledfervldvNllgtfl
00510061   1/1  svealveavleefgrldilvnnaGialpgplegslldlsledfervldvnllgtflltraalplmlkrg.
00394381   1/1  vealveavleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalplmlkr..grivn
00489491   1/1  svealveeileefgrldilvnnaGildldllllgplldlsledwervldvnllgvflltkaalplm..rg
00529881   1/1  ealvaaavellgefgrldilvnnagialllllllgplldlsledwdrvldvnllgvflltraalplmre.
00350181   1/1  ealveavleefggrldilvnnagillpgplldltledfervldvnllgtflltraalpllrkrgggrivn
00517021   1/1  aavleefgrldilvnnagilllgplldlsledwdrvldvnllgtflltraalplmlkr..grivnisSva
00425051   1/1  efgrldiLvnnagialllgplldlsledwdrvldvnllgvflltraalplmlkrgggrivnisSvaglvg
00515421   1/1  vtdeesvaalvaavleefgrldilvnnAGilldgpleeltledwervldvnllgaflltraalplmrkrg
00369221   1/1  lvaavleefgrldilvnnagilldgplldltledfervldvnllgtflltraalplmrkrgggrivnisS
00519651   1/1  alveevleefgrldilvnnAgilgpllgplldlsledfervldvnllgtflltraalplmrkrgggrivn
00451531   1/1  svealveaileefggrldilvnnagillpgplldltledfervldvnllgvflltraalplmrkrgggri
00380681   1/1  veavleefgrldilvnnagillvgplldlsledfervldvnllgtflltraalplmrkrglggrivnisS
00499421   1/1  vleefgrldilvnnagilldgplldltledfdrvldvnllgtflltraalplmrkrgggrivnisSvagl
00498451   1/1  dilvnnAgillpllllgplldlsledwdrvldvnllgtflltraalplmrkrgaasgggggrivnisSva
00368061   1/1  eaaleefgrldilvnnAgillpllllllgplldlsledfervldvnllgtflltraalplmrkrgaesgg
00520851   1/1  eesvealveavleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalpllrkrgggr
00500221   1/1  fgrldilvnnagilllgplldltledfdrvldvnllgvflltraalplmrkrgggrivnisSvagllglp
00510931   1/1  DvtdeesvealveavleefgrldilvnnAgillpgpledltledwervldvNllgvflltraalp.mlkr
00474701   1/1  ealveavleefgrldilvnnagillplgplldlsledfervldvnllgvflltraalpllrkrgggrivn
00416101   1/1  alveavleefgrldilvnnagillpgplldltledfervldvnllgtflltraalplmrkrglggrivni
00417571   1/1  deesvealveavlellleefgrldilvnnAGillplllgpllelsledwdrvldvnllgvflltraalpl
00387701   1/1  veavleefgrldilvnnAgialpgplldlsledfervldvnllgtflltraalplmrkrg.grivnisSv
00388141   1/1  vaavleefgrldilvnnagvlldgplldltledfervldvnllgtflltraalpllrkrgggrivnisSv
00512791   1/1  lveavleefgrldilvnnagillvlgplldlsledwervldvnllgtflltraalplmrkrg.grivnis
00413661   1/1  veavleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalpllrkrgggrivnisSv
00354711   1/1  eavleefggldvlvnnAgillvlllllgpledlsledwervldvNvlgtflltraalplmrkag.grivn
00409101   1/1  svealveealeefgridilvnnAGi........lsledwervldvNllgtflltraalplmrkrglglgg
00486141   1/1  ggldvlvnnagillplgplldlsledwdrvldvnllgtflllraalpllvk.g.grivnisSvagygplp
00361941   1/1  veel....ggldvlvnnagialpgplldlsledfervldvnllgtflltraalplmrkrglggrivniss
00416921   1/1  grldilvnnagiallgplldlsledwdrvldvnllgvflltraalplmlkrgggrivnissvagllglpg
00385451   1/1  aealeefgrldilvnnAgillvgplldlsledfervldvnllgtflltraalpllrkrgggrivnisSva
00519551   1/1  eesvealveeileefgrldilvnnagillpgplldlsledwervldvnllgvflltkaalplmkkrgggr
00482431   1/1  ellealveavleefgrldilvnnaGialpgpllgllllllllldlsleadwervldvnllgvflltraal
00398711   1/1  vaavleefgrldilvnnAgillvgplldlsledfervldvnllgtflltraalplmrkrglggrivnisS
00513551   1/1  eeileefgrlgldilvnnAgillplgplldlsledfervldvNllgtflltkaalplmkkrgalssgell
00424291   1/1  aaveel....ggldvlvnnagiallgplldlsledfervldvnllgtflltraalplmrkaglggrivni
00506551   1/1  alveeileefgrldilvnnAGil.vgpledlsleldfervldvNllgtflltkallplmkks..grivni
00528731   1/1  alveevleefgrldilvnnaGil........sledfervldvnllgtflltraalpllrkrglggggriv
00385591   1/1  ggldvlvnnagilavgeplldlsledwdrvldvnllgtflllraalplmvk..ggrivnissvaglgglp
00436781   1/1  vaaaleefgrldilvnnAgillpllllllgplldlsledfervldvnllgtflltraalplmrkrgaesg
00512601   1/1  vealveevleefgrldilvnnAgillvgplldlsledfervldvnllgtflltraalplmrkrgggrivn
00482861   1/1  alveevleefgrldilvnnAGil..gpledlsledfllervldvNvlgtflltraalpll.lk.ggrivn
00353051   1/1  vealveevleefgrldilvnnAGi........lsledwervldvNllgvflltraalplmrkrglglggr
00512031   1/1  deesvealveeileefgrldilvlnnAGillpgpled.sledwervldvNllgtflltkaalplm.krgg
00527441   1/1  vtdpesvealvaeileef.gldvlvnnAgillvgpledlsledfervldvnvlgtfnllraalpl....g
00511091   1/1  aDvtdeesvealveeileefgrldilvnnAgillpdgpled.sledfervldvNvlgtflltraalp.lr
00507211   1/1  slaaalagv.....riDvvvhnAgi....plvdlseedpeevldvNvlgtlnlleaa...rkagtvgriv
00490261   1/1  vefvegDltdpesleaaleev.....gvDvvvhnAgissvgpse.ltledpeevldvNvlgtlnlleaal
00498641   1/1  aleev.....gvdvvihlAgissv....dlseedpeevldvNvlgtlnlleaarka.....gvgrivfiS
00482931   1/1  eslaaalagv.....rldvvvhnAgissv....dlseedpeevldvNvlgtlnlleaalpag.vkrgggg
00468971   1/1  alagv.....ridvvihnAgiv....lvdlseedpeevldvNvlgtlnlleaalpagvkrggggglslri
00460341   1/1  alagv.....riDvvihnAgivsv....dlseedpeevldvNvlgtlnlleaalpagvkrggggglslri
00493571   1/1  gvefvqgDltdpesleaala.......gvdvvvhnAgivgv....dlseedpeevldvNvlgtlnlleaa
00495191   1/1  peslaaalagv.....rldvvvhnAgivgv....dlseedpeevldvNvlgtlnlleaalpag.vksggr
00511831   1/1  ltdpesleaale......g.vdvvihlAgiasvg.......edpeelidvNvlgtlnlleaarka...gs
00494281   1/1  elaaeveellgdggldvlinnAGillpsgslgeldleellevfevnvlgpllltqallpllkkgaakksg
00480351   1/1  lgralavaadvtdpesvealv.......ggldilvnnagilgallgplldltledwervldvnllgtfll
00532871   1/1  .....g.vdavvhlagivgvgalllllllksllelseedpeevldvnvlg....tlnlleaakaagvkri
00491171   1/1  eslaaala.......gvdvvvhnAgivsv....dlseedpeevldvNvlgtlnllea.arkagvg...ri
00514911   1/1  aleev.....gvdvvvhnAgivgv....dlseedpeevldvNvlgtlnlleaalpa....gvgrivfvSS
00433371   1/1  lagv.....rpdvvvhlAalssv....dlseedpeevldvNvlgtlnl....leaareagvvgrivfvSS
00465741   1/1  peslaaaleev.....gvdvvihnAgi....plvdlseedpeevldvNvlgtlnlleaalpa....gvgr
00371281   1/1  fggvdvvihlAaissvd......esdpeelldvNvlgtlnlleaarka.....gvrfvytSSaavygg.p
00462911   1/1  esleealkgv.....kpdvvihlAaivhv....dlseedpeetidvNvlgtlnlleaarkag.vksggrf
00400431   1/1  ala.......gvdaVvhlAalshv....dlseedpeevlevNvlgtlnlleaarka.....gvrfvfiSS
00419991   1/1  leei.....gvdaVihlAaissv....dlseedpeevldvNvlgtlnlleaarka...gvkprfvfiSSa
00464721   1/1  vdvvihlAgi...vsavdlseedpeevldvNvlgtlnlleaarka....gvkrivfvSSiavyggpgglp
00527221   1/1  slaealkg.......vdvvinaagttrfg.......edleeflavnvdgtlnlaeaakka.gvk...rfv
00465291   1/1  eeieaaggkavvldvsdeedlkelv.......grlDilvnnagipllkplldltkegwdvidvgvldvnl
00519911   1/1  dpeslaaalk.......gvdvvinaagitrvg.......edleefldvnvdg....tlnlldaakkagvk
00383241   1/1  rvefvegDltdpealaaala....efggvdvVihlAalvhv....dlseedpeevldvNvlgtlnlleaa
00430411   1/1  aealk.......gvdvVihlag.......................dvnvlgtlnlleaakkagvkrfvfv
00367851   1/1  ....gdaDvvinaapvglhaeiveaaleagkhvvdenpla..aetralleaakeagvgrivnvssaagya
00519251   1/1  .....vdvvihlAaivgv....dlseedpeetidvNvlgtlnlleaar.....kagvrfvfiSSsavygd
00485161   1/1  klellkelgad.vvidvtdedaveal......agggvdvvvnnaggatlgallel.lapggrvvlvnllg
00430421   1/1  ealk.......gvDvVihlagl...............evidvnvlg....tlnlleaakeagnvkrfvfv
00481861   1/1  ...ealkgadvvviaagip......rkpgedrldlldvnvlgvknlleaaaka....gvgrivlvssnpv
00479651   1/1  inpealeaaaaelgaevvsggealavacdvtdpaavealidaavaafgkldilvnnAgiplvdpeallil
00387841   1/1  dlv....ealggadvvvnnagvp......rkpgeerldllevnvlgtknlaealkka...gpg.rivvvs
00521161   1/1  pealeeale.......gvdaVihlAalssvg....eseedppleflevNvlgtlnlleaarka.....gv
00496861   1/1  d......vvldvtdveellkallk....lggvdvvihtag....apvtelslsllkqllrvnvlgtlnll
00421801   1/1  vsdleeleeal.......ggaDivvnatgaglpglllelllellkpggvvvdvaypp..llttallplar
00484141   1/1  veele.......ellgkvDivinaaglgepaklldllvellervksgnvlgdlllapevlplleeasekg
00348721   1/1  rdted............leelvkeadivvtavgvpdlvkaelgkpgalVnnaGinrl..fdeetledwl-
00352901   1/1  tenleeavkeaDivivavgvpglvkaellkpg--------------------------------------
00516961   1/1  agvdvvihlagvvrf......sagdpeaflavnvdgtlnlleaaraa.....gvkrfvlvSslgaygdpl
00471781   1/1  ...gv.daVihlag...............padpldllevnvdgtrnlleaakaagvkrlvlvssagayg.
00491981   1/1  ealkraladv.....kpdvVihlAavsgp....rvsaadpeavydtnvlgtlnllea.akkag-------
00354771   1/1  tdtddlaealk.......gadvvvhlagv......prkpgedrddllavnvlg....tralleaarkagv
00519961   1/1  ......gvdaVihlAalvsv....deseedplefievnvlgtlnlleaarka....g.krfvf-------
00484551   1/1  kvdvldldd.......laealggadilinatgagmpplledllpldlalllkvnvv--------------
00502281   1/1  kalkgvDvvihaagtsrvdeslkdal.gtnvigtss----------------------------------


                         +         -         -         -         -         *         -:210
query           SAAKSALVGCTKTWALELAKYGICVNAIAPGPVDTELFRKTRPIGSSEEKEVLDSIPMMRIGKPEEIAAT
00515681   1/1  sSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllallllllllllll
00499021   1/1  drvldvnllgvflltkaalplmkk..ggsIvnissiaglrglpglalayaasKaAlegltrslalelapr
00503651   1/1  sSvagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdTpllrgllgllallllllpee
00465921   1/1  ledwdrvldvnllgvflltraalplm..rgggsivnissvaglvglpglalayaasKaAlegltrslale
00421311   1/1  ldvnllgtflltraalplmrkrsaessggggrivnisSvagllglpglaaYaasKaalegltrslalela
00509671   1/1  vnisSlvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllallllllll
00483611   1/1  drvldvnllgvflltqaalplmkk..ggsIvnissiaglvglpglalayaasKaAlegltrslalelapr
00450761   1/1  plmlkr..grivnisSvaglllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpmlaa
00471241   1/1  rivnisSvagllallllllglpglaaYaasKaallgltrslalelaprgirvnavaPglvdTpllagl..
00376621   1/1  rivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllagll..peelle
00464831   1/1  .ldvNllgvflltkaalplmkkaaklskrgggrivnisSvaglrglpglaaYsasKaalegltrslalel
00515111   1/1  rgllggrivnisSvagllglpglaaYaasKaallgltrslalel..tgirvnavaPglvdTdllaallld
00383421   1/1  lgrivnisSvagllglpgqaaYaasKaalegltrslalelaprgirvnavapglvatplterllrlglll
00532861   1/1  ivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdTpllrglld..eellea
00509551   1/1  dggrivnisSvagllglpllglaaYaasKaalegltrslalelllaprgirvnavapglvdtpllralle
00476811   1/1  vnisSvagllglpglaaYaasKaalegltrslalelaptgirvnavaPGlvdTpllrallaalallllll
00517631   1/1  lllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllrgllpllllpeelleallali
00525291   1/1  agllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllallgllgpeellelllalip
00507761   1/1  sSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllallllllllllpe
00437031   1/1  grivnisSvagllvglpglaaYaasKaalegltrslalelaptgirvnavaPglvdTpllrgllllllll
00523681   1/1  glpglaaYaasKaalegltrslalelapkgirvnavaPglvdtpllrglllllllpeelleallkliplg
00380421   1/1  vnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrglll.deelleal
00499431   1/1  gggrivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavaPglvdTpllrglll.lee
00532661   1/1  grivnisSiagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdTpllrglll.peell
00514401   1/1  rkrgggrivniSvagllglpgqaaYaasKaalegltrslalelaprgirvnavaPglvdTpllaalllll
00502371   1/1  sSvagllgglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllagllld.eellealla
00468011   1/1  llelllllllldlledvaglrglplglaaYaasKaalegltrslalelaprgirvnavaPglvdTpllrg
00503831   1/1  ltraalplllkrglggrivnisSvagllglpgqaaYaasKaalegltrslalelaprgirvnavapglvd
00510061   1/1  grivnisSlvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrglla.peel
00394381   1/1  isSvaglllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpllagllallllllllll
00489491   1/1  ggrivnissvagllglpglaaYaasKaalegltrslalelapkgirvnavaPglvdTpllrglll.leel
00529881   1/1  g.gsivnissvgllglpglaayaasKaalegltrslalelaprgirVnavaPgpirTpllaallaalaal
00350181   1/1  isSvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpllaalllllllleellea
00517021   1/1  glglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllaal...leelleallaliplgr
00425051   1/1  lpglaaYaasKaallgltrslalelaprgirvnavaPglvdTpmlaalllglllllleelleallalipl
00515421   1/1  ggrivnisSvagllglpgqaaYaasKaallgltrslalelaprgirvnavaPGlvdTpmtaalle.....
00369221   1/1  vagllglpgqaaYaasKaalealtrslalelaprgirvnavapglvdtpllaal...leelleallalip
00519651   1/1  isSvagllglpgllaaYaasKaalegltrslalelaprgirvnavaPglvdtpllaallldleelleall
00451531   1/1  vnisSvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpllaallllllleelle
00380681   1/1  vagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrallalllllllllleevl
00499421   1/1  glpgqaaYaasKaalegltrslalelaprgirvnavapglvdtpllaal...leelleallaliplgrlg
00498451   1/1  gllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllagllp..eellallldgiplg
00368061   1/1  gggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllagllg..ee
00520851   1/1  ivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllaal...leellea
00500221   1/1  gqaaYaasKaalealtrslalelaprgirvnavapglvdtpllaal...leelleallaliplgrlgtpe
00510931   1/1  gggrivnisSvagllglpglaaYaasKaalegltrslalelaprglgirvnavaPGlvdTpllrgllae.
00474701   1/1  isSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllpllllllpeevl
00416101   1/1  sSvagllglpglaaYaasKaalegltrslalelllaprgirvnavapglvdtpllagllp..eellelll
00417571   1/1  mrkrgllggrivnisSvagllglpglaaYaasKaallgltrslalel..tgirvnavaPglvdTdllaal
00387701   1/1  agllglpglaaYaasKaalegltralalelaprglgirvnavapglvatpllrgllllalleellallld
00388141   1/1  agllglpgqaaYaasKaalealtrslalelaprgirvnavapglvatpllaal...leellelllalipl
00512791   1/1  SvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrglllllllleelleall
00413661   1/1  agllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtplleallellal........ipl
00354711   1/1  isSvaglgglpglaaYaasKaalegltrslarelap.girvnavapglvdtpllrglllpllllalllge
00409101   1/1  rivnisSvagllglpglaaYaasKaalegltrslalelaptgirvnavapglvdTellralllllallee
00486141   1/1  glaaYaasKaavegltrslalelapllkgirvnavapglvdtpllra...........lgdgtplgrlgt
00361941   1/1  vagllglpglaaYaasKaalegltrslalelaprgirvnavapglvatpllralll.leelleallalip
00416921   1/1  laaYaasKaalegltrslalelaprgirvnavaPglvdTpllaglld..eellelllaliplgrlgtpee
00385451   1/1  gllglpglaaYaasKaalealtrslalelaprgirvnavapglvatpllagl...lpellelllaliplg
00519551   1/1  ivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdtpmlaallle.......
00482431   1/1  p..llrggglssglggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavaPglvd
00398711   1/1  vagllglpglaaYaasKaalealtrslalelaprgirvnavapglvatpllagllllllllllllleell
00513551   1/1  slgggrivnisSiagllglpglgllelplaaYaasKaalegltrslalelapkgirvnavapglvdTpll
00424291   1/1  ssvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvltpllralll.leellaallal
00506551   1/1  sSiagllglpdlglllleelllddlllldllellslllelllealleelllglaaYaasKaalegltrsl
00528731   1/1  nisSvagllglpglaaYaasKaalegltrslalllelaptgirvnavapglvrtpllagllpllllllle
00385591   1/1  glaaYgasKaavegltrslalelapllkgirvnavapgnvdtpmlrg...........lldgtplrrlgt
00436781   1/1  lgggrivnisSvagllglpglaaYaasKaalegltrslarelaprgirvnavapglvatpllagllg..e
00512601   1/1  isSvagllglpglaaYaasKaalegltrslalelaplgltgirvnavapglvdtpllaallaa.......
00482861   1/1  vsSvagllglpglddllleelllsdllllllldlllelldlllplledtplgplaaYaasKaalegltrs
00353051   1/1  ivnisSvagllglpglaaYaasKaalegltrslalelaptgirvnavaPglvdTpllaglll.dpellea
00512031   1/1  grivnisSiagllglpgqaaYaasKaalegltrslalelllapkgirvnavaPGlvdtpllaalllalal
00527441   1/1  vgrivniSSiagvlgspgqsaYaasKaalealtrslaae....girvnavrpglvatpglveel......
00511091   1/1  krglgrivnisSiagllglpgqaaYaasKaalealtrslalelallprgirvnavaPGlvdtp.......
00507211   1/1  nvSSagvygdpglggpidEddpldplspYgasKaaaeallralarelaptglllelgirvtivrpgnvyg
00490261   1/1  pa...gvggrivfvSSiavygdpdgpidEddlllvllllllllltplpplsaYgasKaaaelllralare
00498641   1/1  SaavyggseegpidEddpldpplspYgasKaaaellaralarel..ygirvvilrpgnvygpglrpllge
00482931   1/1  rivniSSigvygdpggpidEddplnplsaYgasKaaaeallralarel...girvtilrpgnvygpggrp
00468971   1/1  vfvSSiavyggpggllevllesllgpldeddplnplspYgasKaaaeallralarel...girvtilrpg
00460341   1/1  vfiSsiavygglpgqsgpitEddpldplspYgasKaaaeallralarel...girvtilrpgnvygpggg
00493571   1/1  lpa....gvgrivniSSigvyggpggapidEddplnplspYgasKaaaeallralarel...girvtivr
00495191   1/1  ivniSSiavygdpeglpidEdtplpplspYgasKaaaeallralarel...girvtilrpgnvygpggrp
00511831   1/1  vkrivfvSSiaavygdplllpglpidEdtwldvdllaalllllelplpplspYgasKaaaealaralare
00494281   1/1  eglslsralivnissllGsigdntsgglyaYrasKaALnmltkslaie----------------------
00480351   1/1  traalplmlarg.grivnissiagllglpglaa-------------------------------------
00532871   1/1  vlvSslgayggdedtplpplspygasKaaaeallra.......sglrvtilrpglvlgpllsg...lrlg
00491171   1/1  vfvSSigvyggpgglpidEdtplpplspYgasKaaaeallralarel...glrvtilrpgnvygpgggpg
00514911   1/1  iavyggllllppglpidEddplnplspYgasKaaaelllralare.apygirvtilrpgnvygpllsgll
00433371   1/1  aavyggppglpidEdtplnplspYgasKaaaellaralare...yglrvvilrpgnvygpggrpdgvtsn
00465741   1/1  ivfvSSiavygdpdglpidEgdpglpplspYgasKaaaelllralare..gsgirvtilrpgnvygpgls
00371281   1/1  pglpidEdtplnplspYgasKaaaellvralare...yglrvvilrpgnvygpggrpdgltssviplllr
00462911   1/1  vfiSSsavyggppglpidEddplnplspYgasKaaaelllrayakey...glrvvilrpgnvyGpgggpd
00400431   1/1  aavyggspllllllglllldglpidEdtpldplspYgasKaaaellvrayare...yglrvvilrpgnvy
00419991   1/1  avyggspgqpldesllldvdllpllaitEdtplnplspYaasKaaaealarayare...yglrvvilrpg
00464721   1/1  idEddllllplnplsapYgasKaaaelllralarel...glrvtilrpgnvygpggrpllglsgvlprli
00527221   1/1  lvSslgalg.pspspyaasKaaaeallral.......glprvtivrpglvlgplgeplpgelllagglll
00465291   1/1  lgv-------------------------------------------------------------------
00519911   1/1  rfvlvSslgalg.pspspyaasKaaaeallral.......gldlvtivrpglvlgpllspllgealllpg
00383241   1/1  rka.gvk...rfvfaSSaavyggnplllllddelpidEddplnplspYgasKaaaeklvrayare...yg
00430411   1/1  SsagvygdedtplpplspygasKaaaeallral.......glpvtivrpgnvygpglsg....iplllrl
00367851   1/1  dgrglpayqaakaalealllglalelgiagirvnailpgfvetp--------------------------
00519251   1/1  pkkgpidEddllllnplnplspYgasKlaaekl-------------------------------------
00485161   1/1  gllltrallplllkrgkgrivns....-------------------------------------------
00430421   1/1  SsagvygdedtplnplspygasKaaaekllra.......sglpvtilrpgnvygpgl...sgliplllkl
00481861   1/1  dgl....ayaaskaaleg...........s----------------------------------------
00479651   1/1  ler-------------------------------------------------------------------
00387841   1/1  spagllglp-------------------------------------------------------------
00521161   1/1  krfvfaSSsavygdpeglpidEdtlldvdleplnplspYgasKlaaellarayare...ygldvvilrpf
00496861   1/1  rallpllvk-------------------------------------------------------------
00421801   1/1  arglgrivdglsmlvlqg----------------------------------------------------
00484141   1/1  irvvtglsilgeqgpaq-----------------------------------------------------
00348721   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00516961   1/1  spyarsKaaaeallral.......glprvtilrpglvygprdgfllallll.llllgdgdqrrspihvdd
00471781   1/1  .depgpplplspyaaskaaaeellrasgldytilrpgalfgpg.......rtgvllllgdgdglrslisv
00491981   1/1  ----------------------------------------------------------------------
00354771   1/1  grivvvssgnpvdil-------------------------------------------------------
00519961   1/1  ----------------------------------------------------------------------
00484551   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IAFLLSNEASFITGQVICVDGGGSL---------------------------------------------
00515681   1/1  llpeevaeallaliplgrlgtp------------------------------------------------
00499021   1/1  lgIrVnavaPGpikTpmlaallgll---------------------------------------------
00503651   1/1  vaeallkliplgrlgtpedvagavlf--------------------------------------------
00465921   1/1  laprlgirVnavaPgpidTpllaal---------------------------------------------
00421311   1/1  prgirvnavaPglvdTpmlral...---------------------------------------------
00509671   1/1  lelleallaliplgrlgtpedvadav--------------------------------------------
00483611   1/1  lgIrVnavaPgpiltpmlaallgal---------------------------------------------
00450761   1/1  lllllllllllilvleelleallal---------------------------------------------
00471241   1/1  .peelleallaliplgrlgtpeevad--------------------------------------------
00376621   1/1  allaliplgrlgtpeevaeavl------------------------------------------------
00464831   1/1  apkgirvnavaPGllvdTpllr...---------------------------------------------
00515111   1/1  llleelleallaliplgrlgtp------------------------------------------------
00383421   1/1  lspeevaeallaallsgepvvvvgl---------------------------------------------
00532861   1/1  llkliplgrlgtpeevadavlflasd--------------------------------------------
00509551   1/1  ...elleallaliplgrlgtped-----------------------------------------------
00476811   1/1  llllldllelleallaliplgrlgt---------------------------------------------
00517631   1/1  plgrlgtpedvadavlflasdaasy---------------------------------------------
00525291   1/1  .rlgtpeevadavlflasdaasyvtgq-------------------------------------------
00507761   1/1  evaealldliplgrlgtpedvadavl--------------------------------------------
00437031   1/1  llleelleallaliplgrlgtpeeva--------------------------------------------
00523681   1/1  rlgtpeevadavlflasdaasyit----------------------------------------------
00380421   1/1  laliplgrlgtpeevaeavlfl------------------------------------------------
00499431   1/1  lleallkliplgrlgtpeevadavlfl-------------------------------------------
00532661   1/1  eallkliplgrlgtpedvadavlfla--------------------------------------------
00514401   1/1  peellealldliplgrlgtpedvada--------------------------------------------
00502371   1/1  liplgrlgtpeevadavlflasdaas--------------------------------------------
00468011   1/1  llal.eelleallalilplgrlgtpe--------------------------------------------
00503831   1/1  Tpllrgllllpeelleallaliplgr--------------------------------------------
00510061   1/1  leallellellldliplgrlgtpedv--------------------------------------------
00394381   1/1  lpeelleallaliplgrlgtpeev----------------------------------------------
00489491   1/1  leallkliplgrlgtpeevadavlfl--------------------------------------------
00529881   1/1  lllllleelleallaliplgrllgt---------------------------------------------
00350181   1/1  llaliplgrlgtpeevaeavlf------------------------------------------------
00517021   1/1  lgtpeevaeavlflasdeasyitgqv--------------------------------------------
00425051   1/1  grlgtpeevadavlflasdaas------------------------------------------------
00515421   1/1  ........plgrlgtpeevada------------------------------------------------
00369221   1/1  lgrlgtpeevaeavlflalsdeasy---------------------------------------------
00519651   1/1  alillplgrlgtpedvadavlflas---------------------------------------------
00451531   1/1  allaliplgrlgtpeevaeavl------------------------------------------------
00380681   1/1  ealldliplgrlgtpedvaeavlfla--------------------------------------------
00499421   1/1  tpeevadavlflasdeasyitgqvlvv-------------------------------------------
00498451   1/1  rlgtpedvadavlflasd..sy------------------------------------------------
00368061   1/1  llelllaliplgrlgtpeevaeavlfl-------------------------------------------
00520851   1/1  llaliplgrlgtpeevadavlflasd--------------------------------------------
00500221   1/1  evadavlflasdeasyitgqvlvvd---------------------------------------------
00510931   1/1  ..........iplgrlgtpeev------------------------------------------------
00474701   1/1  eallaliplgrlgtpedvadavlflas-------------------------------------------
00416101   1/1  aliplgrlgtpeevaeavlflasdda--------------------------------------------
00417571   1/1  llglldpelleallaliplgr-------------------------------------------------
00387701   1/1  giplgrlgtpedvaeavlflas------------------------------------------------
00388141   1/1  grlgtpeevaeavlflasddasy-----------------------------------------------
00512791   1/1  aliplgrlgtpeevadavlflasd.as-------------------------------------------
00413661   1/1  grlgtpeevaeavlflasdeas------------------------------------------------
00354711   1/1  llevlgdgiplgrlgtpedvad------------------------------------------------
00409101   1/1  lleallaliplgrlgtpeevae------------------------------------------------
00486141   1/1  pedvaeavlflasdaaslyitg------------------------------------------------
00361941   1/1  lgrlgtpedvaeavlflasdpasyit--------------------------------------------
00416921   1/1  vaeavlflasdaasyitgqvlv------------------------------------------------
00385451   1/1  rlgtpeevaeavlflasdeasy------------------------------------------------
00519551   1/1  .....plgrlgtpeevaeavlflas---------------------------------------------
00482431   1/1  Tpll.....lpeelleallaliplg---------------------------------------------
00398711   1/1  ealldgiplgrlgtpedvaeavlfla--------------------------------------------
00513551   1/1  rgl..................Alltp--------------------------------------------
00424291   1/1  iplgrlgtpedvadavlflasdpasy--------------------------------------------
00506551   1/1  alelllllapkgirvnavaPGlvdtpl-------------------------------------------
00528731   1/1  ellealldliplgrlgtpedvaeav---------------------------------------------
00385591   1/1  pedvaeavlflasdeasyitgq------------------------------------------------
00436781   1/1  ellealldliplgrlgtpe---------------------------------------------------
00512601   1/1  ......lgrlgtpedvaeavlflas---------------------------------------------
00482861   1/1  larelllllapkgirvnavaPglvdt--------------------------------------------
00353051   1/1  llaliplgrlgtpeevaeavlf------------------------------------------------
00512031   1/1  llllllalallllaallaaaaa------------------------------------------------
00527441   1/1  laellariplgrl.tpedvarav-----------------------------------------------
00511091   1/1  ......................------------------------------------------------
00507211   1/1  pglgfpgnllplllraalaglplp----------------------------------------------
00490261   1/1  l...girvtilrpgnvygpglrplg---------------------------------------------
00498641   1/1  dplgalggllplllraalgkge------------------------------------------------
00482931   1/1  glvtsllplflrlalaglpltlvlg---------------------------------------------
00468971   1/1  nvygpggrp.gnllplllraalagk---------------------------------------------
00460341   1/1  pgnllplllr.aalaglplpvlgdg---------------------------------------------
00493571   1/1  pgnvygpglrplgvtgsllplllra---------------------------------------------
00495191   1/1  llvtsllplflrlalaggplplvlg---------------------------------------------
00511831   1/1  lap.glrvvilrpgnvygpglr------------------------------------------------
00494281   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00532871   1/1  gllllgdgdalrsfisvedvadavv---------------------------------------------
00491171   1/1  nllplllr.aalaglpltvlgdgdq---------------------------------------------
00514911   1/1  gelllgvpgsliplllraalgg------------------------------------------------
00433371   1/1  liplllrlalggepltvlgdgd------------------------------------------------
00465741   1/1  pllgelllgvpdsllplflraa------------------------------------------------
00371281   1/1  lalagepltlvlgdgdqlrdfi------------------------------------------------
00462911   1/1  gvtskviplliraalkgkplpi------------------------------------------------
00400431   1/1  Gpggrpe.sliplllraalkgg------------------------------------------------
00419991   1/1  nvyGpggrp.glpsgvlpllir------------------------------------------------
00464721   1/1  rlallaalaglpvltvlgdgdqv-----------------------------------------------
00527221   1/1  lgdgdakrspisvddvaralva------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00519911   1/1  llllgdgdakrrpisvedvara------------------------------------------------
00383241   1/1  lpvvilrpgnvyGpggspllge------------------------------------------------
00430411   1/1  alkggpllilgdgdakrdfvhv------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00519251   1/1  ----------------------------------------------------------------------
00485161   1/1  ----------------------------------------------------------------------
00430421   1/1  alkggpllilgdgdqkrdfih-------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00479651   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00521161   1/1  nvyGpgdrpngvtgsviplliraal---------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00348721   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00516961   1/1  varalvaalldpaaa..gkvyn------------------------------------------------
00471781   1/1  ddvAaalvlaledp..eaagkvy-----------------------------------------------
00491981   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00519961   1/1  ----------------------------------------------------------------------
00484551   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------