[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30916.1


[Show Plain Result]

## Summary of Sequence Search
   1::106
   1::106  2.2e-32 44.3% 0051187 00511871 1/1   like                                    
   1::105    4e-29 45.6% 0050298 00502981 1/1   like                                    
   1::106


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MILTTADTLGKREIIEYKGLVTGIIVRTPTITQGILGGLKNIIGGKNTSYTNVCKEARLHAEQEMINQAK
00511871   1/1  mivtttetiegyeiveylglvfgevvrsrnilkdllaglrdlvggelgayeelleeareealerlveeAe
00502981   1/1  mivtttnsiegyeiveylglvfgevvlsrnilkdllaglrdivggelkaytelleeareealerlveeAe


                         -         -         *         -         -         -         -:140
query           ELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVVVR----------------------------------
00511871   1/1  elgAnavvgvrldtseigqggsmlevlayGTAVvle----------------------------------
00502981   1/1  elgAnavvgvrldtseiggg..mlevlayGTAVvl-----------------------------------