[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30919.1


[Show Plain Result]

## Summary of Sequence Search
   1::206
   6::208  8.5e-54 34.2% 0034957 00349571 1/1   hydrobiopterin biosynthesis enzymes-lik 
  25::208  6.7e-53 34.6% 0037473 00374731 1/1   hydrobiopterin biosynthesis enzymes-lik 
  35::206  2.1e-45 38.2% 0050713 00507131 1/1   hydrobiopterin biosynthesis enzymes-lik 
   1::206


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMMKDKYCSKLGKSVQEHLIKLGLEQPREFNLDNDNKITIITKAYRQILDALGLYTDEFEKTPFRVARMF
00349571   1/1  -----llllklrlllldalllkglednlllllldledeldleeieeavrelLealgedpdreglleTPkR
00374731   1/1  ------------------------lllllleledeldleeieeavrelLealgedpdreglleTPkrvak
00507131   1/1  ----------------------------------eldleeieeavrellealgedpdreglleTPkRvak


                         -         -         *         -         -         -         -:140
query           TQEIFNGLDYANFPACALYENEFNYTGVLTQKNITIMSFCEHHFVPFEGTAEVSFIPKNNNIIGLCRINS
00349571   1/1  vakayleelfsGlrydlaevlttflndegldelvlvkdieftSlCehhllPffgkvhvaYiP.dgkvvGl
00374731   1/1  ayl.elfsGldldpeevletflneegldelvlvkdieftslCehhllPffgkvhvaYiP.dgkvvGlskl
00507131   1/1  ayl.elfsgldldpaevlelflneegldelvlvkdieftslCehhllPffgkahvaYiP.dgkvvGlskl


                         +         -         -         -         -         *         -:210
query           ICDFFSRRPQIQERMTAQIFEALKFILSTEDVSVKIKAKHACVSLRGVNNQNSQTYTQMVGGVFAK----
00349571   1/1  sklarlvdvfarrlqvqErltnqIadalvellkprgvaVvieAeHlcmlmRGvkktgsstvtsallGv--
00374731   1/1  arlvdsfarrlqvqErltnqIadalvellkprgvaVvieAeHlcmtmrGvvktgsltvtsallGlfke--
00507131   1/1  arlvdvfarrlqvqErltnqiadalvellkpkgvaVvieAehlcmtmRGviktgsltvtsallGvF----