[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD30942.1


[Show Plain Result]

## Summary of Sequence Search
   1::405
  38::257  6.6e-12 22.9% 0052866 00528661 1/1   like peptide ligases, catalytic domain  
  38::245  1.9e-10 20.3% 0042137 00421371 1/1   like peptide ligases, catalytic domain  
  35::161  1.4e-09 30.2% 0045483 00454831 1/1   like peptide ligases, catalytic domain  
  34::246  6.5e-09 24.9% 0038085 00380851 1/1   like peptide ligases, catalytic domain  
   1::405


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTTLDFWLIVVVFVILCVYLIIENIVHNNSIKSIPIRIHVNGTRGKSSVARLIAAGVRAGGYRTVAKTTG
00528661   1/1  -------------------------------------iaVtGTnGKttTtallasileaaglkvglytsp
00421371   1/1  -------------------------------------iavtGTnGKTTttallaaileaaglkvgalign
00454831   1/1  ----------------------------------dielalllldlpviavTGTnGKTTttsliaailkaa
00380851   1/1  ---------------------------------klpviavTGTnGKTTttsllaaileaagl..vvalig


                         -         -         *         -         -         -         -:140
query           TLARYIDVDGSETPVFRIGFSNIAEQVKIMFKARRAKADAIVIECMALQPLLQSLCELKLIKATHGVLTN
00528661   1/1  glvlfneriringepisdellarlfeevlnalegnlnlgigvpltpfelltllalllfadegvdvaVlEv
00421371   1/1  inneigerltlg........................gvdlaVlEvgssgllflt......lrpdvavitn
00454831   1/1  glvvalggnigvp..........................llllllegvdvaVlElssfql.....grlel
00380851   1/1  nignligvp...................allllldggvdvaVlEvssfdlgflldltnll..rpdvavit


                         +         -         -         -         -         *         -:210
query           ARPDHLDVMGPTERDVAKALAATVPIGAKYFTAEDIHLDFFEYACKDRGSELIAATAQDAEKISDEEINK
00528661   1/1  gsggl.ldatnvld...pdvavitniglDHldylgdtleeiaaaKagifkpggpavlnaddplvlavlee
00421371   1/1  igldHldylggtleaiaaakaeifkglppggvavlnaddpllaelaeragarvvtfgldegadlraldiv
00454831   1/1  lrpdvavitnispdHldrhgn-------------------------------------------------
00380851   1/1  nigldHldyhg.tleeyaaakaeifkglppggvavlnaddpllaallerlagarvvtfglddegadlral


                         -         -         -         +         -         -         -:280
query           FVYSEFKINVALALKVTDDLGIPREIALKGMWEATPDPGAMTEYNFNIKNAEINFANAFAANDPVSTKML
00528661   1/1  laaevltfgllvgadlraedielsldglrftllgpgglllelelpll-----------------------
00421371   1/1  ltldgttftlllpgglllelrlp.lpGrhnvlNal-----------------------------------
00454831   1/1  ----------------------------------------------------------------------
00380851   1/1  divllldgtsftlllpggllevelplpgrhnvlNal----------------------------------


                         -         *         -         -         -         -         +:350
query           WDKLCAKYSGCDKKVLVVNCRDDREDRSKQMAEAALGWQKQDLIVLIGTGTEVFTSFYKKYAKSLNKPMT
00528661   1/1  ----------------------------------------------------------------------
00421371   1/1  ----------------------------------------------------------------------
00454831   1/1  ----------------------------------------------------------------------
00380851   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KVIVCEEMTPIQILEKTVDSNPANSYILVGVGNIKDIGMELVDYCDTSHKKKHNL---------------
00528661   1/1  ----------------------------------------------------------------------
00421371   1/1  ----------------------------------------------------------------------
00454831   1/1  ----------------------------------------------------------------------
00380851   1/1  ----------------------------------------------------------------------