[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD31006.1


[Show Plain Result]

## Summary of Sequence Search
   1::509
   1::504  3.4e-67 22.5% 0042501 00425011 1/1   eneral substrate transporter            
  12::504  9.4e-64 23.7% 0042480 00424801 1/1   eneral substrate transporter            
   1::509


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQASNTITVGFWSQKRTIVALAISLLALAEIVDLTIVAVAIPQIMGAIGANVETIADVTTVYIVTAAIFI
00425011   1/1  Msdsssseeddpelprpllrrrrwrillllflgyflagldrsiigpalpll.edlglsaaqaglllsaff
00424801   1/1  -----------Mkekrrrvllllflgyflsgldfgligpllplilkdflglsaaqigllfsayllgaalg


                         -         -         *         -         -         -         -:140
query           LLSGLIIEKYGIKRVALVSSVIFGISSIMCGLSTSLAEMIVFRAFQGMGGAFLPSVAQTYISTSFKNEEY
00425011   1/1  lgyalgallaGplaDrfGrrrvlllglllfalgslllalaallgpslalllllrflqGlgagglfpaala
00424801   1/1  splaGrlsDrfGrrkvlllglllfalgslllafaptystslwlllllrflqGlgagglfpaalaliaelf


                         +         -         -         -         -         *         -:210
query           NKMMTIYSMVIVMGPIIGPVLGGAICENMSWEWIFYVNVPLCIVAFIIIAFMMEATQIKKIKIDYISFGF
00425011   1/1  llaewfppkergralglfgaggglGgalgpllggllleldlgWrwafliaailalllalllllllpespr
00424801   1/1  ppeerglaleygllsaggslGallgpllggllld.lgwrlvfliaailalllllllllflpesprflaak


                         -         -         -         +         -         -         -:280
query           MAIGVGCLELFIDNGNTNGWFSSIKMIILLAISLVSIGFFIWRGLIYSSVVKFKIFKNFNFVLACFLCFM
00425011   1/1  flllkglseeerkvlerrlkad................................................
00424801   1/1  gklee...............................................ekkaslklslkellknpr


                         -         *         -         -         -         -         +:350
query           FVLLFSAAMAYLPTMLQQVYGYPVDLAGYITAPRGIAAIIGAMLTQSILVKKLGVRKTISLGMITFGVSC
00425011   1/1  .aeakaasplsllellrnprflllllayfllflgfyglltflplylqevlglsasqaglllalfglggil
00424801   1/1  llllllavfllflgfyalltylplylqslfevlglsasqaglllalfglggilgs.llagrlsdrlgrrr


                         -         -         -         -         *         -         -:420
query           LMQANFSPTANEFDIILTTAIQGLGMMMFFVPFMSVLVVGVADEDMGDMSGSFNFFRNFGSSVGTAFVAT
00425011   1/1  gs.llagrlsdrlpegrrrrllliglllaalgllllall.pgtslallllllfllgfglggafpllfalv
00424801   1/1  llligllllalgllllal.ap..slwllllllillgfgfglafpllfallselfppelrgtalgllnlla


                         -         -         +         -         -         -         -:490
query           FISRNQQTTYLELSQNISSLNNNFQSWSHSLPMPDLATVALAKQQVLHQSSLLSYINSFYVVGILSLILA
00425011   1/1  aelfppelrgtasgllnlagnlggallgpllaglllda................................
00424801   1/1  gslggalgpllaglllda................................................lgys


                         *         -         -         -         -         +         -:560
query           IVPFLLKEPPTGAPVAVMH---------------------------------------------------
00425011   1/1  ..............--------------------------------------------------------
00424801   1/1  aaflllaalallal--------------------------------------------------------