[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD31053.1


[Show Plain Result]

## Summary of Sequence Search
   1::455
   3::455  3.4e-87 29.0% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
   2::455  1.5e-83 30.1% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
   3::455  4.2e-64 32.0% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
   4::447  9.3e-53 31.7% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
   6::456  9.5e-44 28.8% 0040238 00402381 1/1   p containing nucleoside triphosphate hy 
   4::428  4.4e-43 30.2% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
   5::445    1e-39 33.2% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
   1::447  1.6e-39 33.1% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  12::454  6.8e-37 31.2% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  10::452  2.6e-36 29.1% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
   8::442    7e-36 29.6% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
   8::448  7.3e-36 31.3% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
   2::422  5.1e-35 33.8% 0049053 00490531 1/1   p containing nucleoside triphosphate hy 
   5::448  1.1e-34 27.8% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
   9::448  4.5e-32 27.3% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
   4::357  5.9e-31 27.3% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
   3::449  8.9e-31 28.4% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
   5::430  2.9e-30 24.7% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
   5::444  2.9e-29 26.1% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  17::414  1.4e-28 31.1% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
   5::432  1.9e-28 27.6% 0049491 00494911 1/1   p containing nucleoside triphosphate hy 
   4::424  4.6e-28 28.7% 0047665 00476651 1/1   p containing nucleoside triphosphate hy 
   1::425  5.8e-28 29.8% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
   8::439  1.7e-23 29.8% 0046258 00462581 1/1   p containing nucleoside triphosphate hy 
   2::443  9.4e-22 26.3% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  18::391  1.2e-21 27.7% 0049757 00497571 1/1   p containing nucleoside triphosphate hy 
   2::415  1.7e-20 24.6% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  10::415  1.1e-17 27.8% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  16::427  3.5e-16 25.7% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  52::358  1.6e-15 30.7% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  13::447    4e-15 24.5% 0046826 00468261 1/1   p containing nucleoside triphosphate hy 
   7::415  4.4e-15 23.4% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  17::418  2.8e-13 28.1% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
  16::405  5.1e-13 28.0% 0045717 00457171 1/1   p containing nucleoside triphosphate hy 
  50::453  1.8e-12 30.3% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  51::446  2.6e-10 23.8% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
  51::419  3.7e-10 25.8% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  45::137  8.2e-10 31.0% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
   5::429  2.2e-09 26.1% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  45::270  2.2e-09 26.7% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  45::106  2.3e-09 38.2% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
  52::138  2.8e-09 33.8% 0050194 00501941 1/1   p containing nucleoside triphosphate hy 
  51::103  5.2e-09 38.0% 0049398 00493981 1/1   p containing nucleoside triphosphate hy 
  51::137  5.4e-09 29.5% 0045970 00459701 1/2   p containing nucleoside triphosphate hy 
  51::134  5.7e-09 33.8% 0047933 00479331 1/2   p containing nucleoside triphosphate hy 
  51::137  6.2e-09 26.4% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  51::137  1.2e-08 29.8% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
  50::114    2e-08 28.6% 0049190 00491901 1/1   p containing nucleoside triphosphate hy 
  51::137  4.3e-08 25.9% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
  45::101  9.1e-08 35.8% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  39::106  1.3e-07 37.1% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  52::110  3.8e-07 28.8% 0051580 00515801 1/1   p containing nucleoside triphosphate hy 
  47::142    4e-07 20.2% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
  51::106  6.8e-07 32.7% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  50::85   7.1e-07 37.1% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  50::97   1.6e-06 35.4% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  45::270  1.7e-06 33.7% 0048050 00480501 1/1   p containing nucleoside triphosphate hy 
  52::448  2.2e-06 20.8% 0048692 00486921 1/1   p containing nucleoside triphosphate hy 
  52::229  2.3e-06 20.4% 0049306 00493061 1/1   p containing nucleoside triphosphate hy 
  52::85   3.5e-06 41.2% 0046459 00464591 1/1   p containing nucleoside triphosphate hy 
  51::80     4e-06 46.7% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  38::269  5.1e-06 25.0% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  51::132  5.2e-06 20.7% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
  49::133  6.4e-06 25.0% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  51::85   6.8e-06 37.1% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
  52::80   6.9e-06 41.4% 0048689 00486891 1/1   p containing nucleoside triphosphate hy 
  51::80   7.1e-06 46.7% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
  52::80   1.1e-05 44.8% 0051851 00518511 1/1   p containing nucleoside triphosphate hy 
  51::104  1.2e-05 32.1% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  51::88   1.2e-05 37.8% 0053247 00532471 1/2   p containing nucleoside triphosphate hy 
  48::80   1.6e-05 41.9% 0045788 00457881 1/1   p containing nucleoside triphosphate hy 
  51::103  1.6e-05 30.8% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  51::82     2e-05 40.6% 0049919 00499191 1/2   p containing nucleoside triphosphate hy 
  51::102  2.5e-05 28.8% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
  52::353  3.1e-05 23.2% 0036317 00363171 1/1   p containing nucleoside triphosphate hy 
  51::80   3.8e-05 44.8% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  51::85   4.4e-05 34.3% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
  52::82   4.6e-05 32.3% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  47::83   6.4e-05 32.4% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
  45::104  7.9e-05 25.0% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  51::73   9.6e-05 65.2% 0048381 00483811 1/2   p containing nucleoside triphosphate hy 
  47::280  9.9e-05 23.9% 0052931 00529311 1/1   p containing nucleoside triphosphate hy 
  51::134  0.00013 23.2% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
  51::80   0.00014 36.7% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  52::85    0.0002 38.2% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  50::115  0.00022 18.2% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
  49::93   0.00029 36.8% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  52::240  0.00029 21.3% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  51::82   0.00036 34.4% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
   8::271  0.00041 17.8% 0050356 00503561 1/1   p containing nucleoside triphosphate hy 
  51::80   0.00044 40.0% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
  16::91   0.00045 23.5% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
  49::111  0.00055 25.4% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
  51::426  0.00099 21.9% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
  51::82    0.0014 50.0% 0050989 00509891 1/2   p containing nucleoside triphosphate hy 
 192::203       10 58.3% 0045970 00459702 2/2   p containing nucleoside triphosphate hy 
 192::203       10 41.7% 0053247 00532472 2/2   p containing nucleoside triphosphate hy 
 192::203       17 72.7% 0047933 00479332 2/2   p containing nucleoside triphosphate hy 
 193::203       17 63.6% 0050989 00509892 2/2   p containing nucleoside triphosphate hy 
 193::203       22 63.6% 0048381 00483812 2/2   p containing nucleoside triphosphate hy 
 193::203       23 54.5% 0049919 00499192 2/2   p containing nucleoside triphosphate hy 
   1::455


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARR
00379261   1/1  --drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlara
00368501   1/1  -kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtlara
00418301   1/1  --drplleklrpvllddviGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlara
00444381   1/1  ---asdelekllelrpvlledvigqeeakkalslalelplkrlelfgklddligrspairrllellgarp
00402381   1/1  -----Plsklleddlplllklrpdlfddvvgqdeaieallealrrarkglnlglkp.....rgnvlLvGp
00430121   1/1  ---iPvsklleddrplleklrpvlfddvvgqeeakeallealrrgrkglelgir.....pggnvllvGPp
00521551   1/1  ----plveklrpvllddvigqeeakealleal.arlkapelflslglr.pgkgvlLvGppGtGKTtlara
00402371   1/1  ktgipltkllrpvllddviGqeealeallealrrr..............pgrnvllvGppGvGKTtlara
00367291   1/1  -----------vtlddvv.gqeeakeallealelalkgldlflslg.lrpgrnvllyGppGtGKTtlara
00420941   1/1  ---------lrpvllddvigqeeakeallealalplkrldlglsl.girpgkgvllyGppGtGKTtlaka
00392701   1/1  -------eklrpvllddvvgqeeakeallealagarlaledls..lgirpgknvlLvGppGvGKTtlara
00473941   1/1  -------eklrpvllddvvgqeevkkalllalalallrge.........pgehvlLvGppGtGKTtlara
00490531   1/1  -tlpaleseardltekarpvlldd.viGqeeaierllealerg..............ppgnvLlvGppGt
00406781   1/1  ----plveklrpvllddvigqeeakealleala..glrlllkdlslgippgknvllvGppGtGKTtlaka
00386741   1/1  --------klrpvllddvvgqeeakeallealkavllgir.........pgehllLvGppGtGKTtlara
00394721   1/1  ---lplleklrpvllddvvgreealeallealrrg..............pprnvlLvGppGvGKTtlaka
00437901   1/1  --slllvekyrpvllddvvgqeeakeallealalararplkrpelflslgirpgrillLyGppGvGKTtl
00527261   1/1  ----npfilgpkvdledfigreeelkeleeal..................pkivlltGprGsGKTtllka
00503741   1/1  ----fifldlrplallplp.drlvgrdeeiealskalggaldgvslsiep.....ggivllvGppGvGKT
00416171   1/1  ----------------diigqeeakkallealslaa............rtgenvllvGppGtGKttlara
00494911   1/1  ----llveklrpvllddlvgqeeakealleala..............agrpghvllvGppGtGKTtlara
00476651   1/1  ---yeplveklrpvllddlvgqeeakealleala.............ggrpprpvllvGppGtGKTtlar
00474201   1/1  deelelleklslllveklrpvllddlvgqeeakeallealr..............agrpghvllvGppGt
00462581   1/1  -------edleslllnplvkfedivpkvlddleealealaea.klp..............ppkgvllyGp
00437921   1/1  -lglllveklrpkllddvvgqeealerlllalk................agklphlllvGppGvGKTtla
00497571   1/1  -----------------aselvqwlldlgildeseilledlenalalllsligaklvkdllllvlkylps
00437941   1/1  -lrplveklrpknlddvy.gqeevlkalslalekg..............rpehlllvGppGtGKTtlaka
00379961   1/1  ---------yrpvdfddivGqeealralslalaag..............ppegvllvGppGtGKstlara
00470731   1/1  ---------------arpltfddvvgqdeakeeleel.........lag.llgikkpkvillvGppGsGK
00512891   1/1  ---------------------------------------------------evilltGppGvGKTTlaka
00468261   1/1  ------------sahvelterlrpvllstivgredqieellellfgglhrgdrl........iglvliyG
00404191   1/1  ------vellpkvtlddlvgleelkealkealell.........slgikpgeivllyGppGtGKTtlaka
00482661   1/1  ----------------kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiayqyallak
00457171   1/1  ---------------lddivgleeakelllealla.............grlphalLlyGppGtGKttlak
00519581   1/1  -------------------------------------------------kpkvilltGppGvGKttlarl
00477721   1/1  --------------------------------------------------kpklilltGppGsGKttlar
00496061   1/1  --------------------------------------------------gklivltGppGsGKtTlakl
00472911   1/1  --------------------------------------------mkmk.kgklilltGppGsGKtTlara
00437981   1/1  ----lveklrpknldkvi.gqeealkdlslalk................pgeiphalllvGppGsGKttl
00478391   1/1  --------------------------------------------msik.kgklilltGppGsGKtTlara
00516041   1/1  --------------------------------------------mlk...gklillvGppGsGKtTlara
00501941   1/1  ---------------------------------------------------klilltGppGsGKttlara
00493981   1/1  --------------------------------------------------kpklilltGppGsGKttlar
00459701   1/2  --------------------------------------------------MpkvillvGppGsGKTTlak
00479331   1/2  --------------------------------------------------apkli.ltGppGsGKttlak
00499331   1/1  --------------------------------------------------PslslkkgklivltGppGsG
00477561   1/1  --------------------------------------------------kkpkvillvGppGsGKtTla
00491901   1/1  -------------------------------------------------lmkgkiilltGppGsGKttla
00515351   1/1  --------------------------------------------------mngklivltGppGsGKtTla
00489631   1/1  --------------------------------------------M....kgklillvGppGsGKtTlara
00533151   1/1  --------------------------------------Msldik.....kgklivltGppGsGKtTlarl
00515801   1/1  ---------------------------------------------------llIvltGppGsGKtTlakl
00512061   1/1  ----------------------------------------------kkkkgklivltGppGsGKtTlaka
00489391   1/1  --------------------------------------------------lsikkgklivltGppGsGKt
00487061   1/1  -------------------------------------------------ldMkkgklIvieGppGsGKtT
00461621   1/1  -------------------------------------------------mkgmiialtGppGsGKsTlak
00480501   1/1  --------------------------------------------M.....gklillvGppGsGKtTlara
00486921   1/1  ---------------------------------------------------mlivltGppGsGKtTlaka
00493061   1/1  ---------------------------------------------------mlIvltGppGsGKtTlaka
00464591   1/1  ---------------------------------------------------klivltGppGsGKtTlaka
00478081   1/1  --------------------------------------------------gkvivltGppGsGKtTlarl
00513251   1/1  -------------------------------------iellsdlslsipspevvllvGppGsGKstlakk
00381441   1/1  --------------------------------------------------GeliaivGpsGsGKsTLlkl
00451571   1/1  ------------------------------------------------MsikkgeiiaivGppGsGKsTl
00457851   1/1  --------------------------------------------------PkgklivltGppGsGKtTla
00486891   1/1  ---------------------------------------------------mlivltGppGsGKtTlaka
00478131   1/1  --------------------------------------------------kgkvivltGppGsGKtTlar
00518511   1/1  ---------------------------------------------------klIvleGpsGsGKsTlakl
00476071   1/1  --------------------------------------------------kgkiigltGpsGsGKsTlak
00532471   1/2  --------------------------------------------------pGkiIvitGpsGsGKsTlar
00457881   1/1  -----------------------------------------------m..gklivltGppGsGKtTlakl
00498811   1/1  --------------------------------------------------kPgkiigltGpsGsGKsTla
00499191   1/2  --------------------------------------------------kgkiigitGpsGsGKsTlak
00426051   1/1  --------------------------------------------------kpgevialvGpsGsGKSTla
00363171   1/1  ---------------------------------------------------ikplklispfeprpyQqea
00482721   1/1  --------------------------------------------------kgkiigltGpsGsGKsTlar
00493171   1/1  --------------------------------------------------mgklivllGpsGaGKsTlak
00469161   1/1  ---------------------------------------------------llIvieGppGsGKsTlakl
00420081   1/1  ----------------------------------------------smkkglrIaleGpsGvGKTTlakl
00475381   1/1  --------------------------------------------mk....geiialtGpsGsGKsTlarl
00483811   1/2  --------------------------------------------------PkvillsGpPGvGKTtlaaa
00529311   1/1  ----------------------------------------------edlklllrllagrllhalLlyGpp
00496571   1/1  --------------------------------------------------GkgelivllGpsGsGKsTla
00462761   1/1  --------------------------------------------------yygdvtaldgvsltikkgev
00480441   1/1  ---------------------------------------------------rlivllGpsGaGKsTlakl
00493431   1/1  -------------------------------------------------kGelivllGpsGaGKsTllkl
00487021   1/1  ------------------------------------------------rm..kiivltGpsGsGKsTlar
00513761   1/1  ---------------------------------------------------kiiaivGkgGsGKTTllnk
00464411   1/1  --------------------------------------------------vkkgeiivllGpsGsGKsTl
00503561   1/1  -------kPydrLldivgigfltaddialalgiagdsperlllalallsellgeghlylplddlveellk
00508671   1/1  --------------------------------------------------hvsllklgeldislsikkge
00471271   1/1  ---------------prailelesliksllekllellkrlslklk.....kglkvalvGrpgvGKStLln
00414121   1/1  ------------------------------------------------kpgevvllvGpsGaGKTTLlra
00457311   1/1  --------------------------------------------------mkkgeiigivGpsGsGKSTl
00509891   1/2  --------------------------------------------------pkvigitGpsGsGKTTlana
00459702   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMKREEAKEKVTEKAARLAEDRILDVLIPPA
00379261   1/1  lAkllgapfvevdaselteggyvgedlekrirelfqearllvfltvlenirldaseylekrvvsrligap
00368501   1/1  lakllgapfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpgtvlenlalgllvseligap
00418301   1/1  lakllgrpfirvdaselteaelvGyesgarlrelfara................................
00444381   1/1  genvlLvGppGtGKTtlakalakllgvpfiridgseltekelvGesegailsggfkqrvgialla.....
00402381   1/1  pGtGKTtlaralakalgvpfvrinlselteallvsdliGhldgyvgededgiltgalr............
00430121   1/1  GvGKTtlakalagllfpsgvpfirinlseltekllvselighppgyvGedelgvlf..............
00521551   1/1  lagllgapfvrlsaselvg.kyvgeleggl.rql....................................
00402371   1/1  lagllvrssgpilldgvpfvrldasellefgkyvgafegglrqllg........................
00367291   1/1  lanelgapfirvdaselle.klvg.egegrlrgalaealrad............................
00420941   1/1  lagelgapfiridgsellg.kyvgelsggl.rqlla..................................
00392701   1/1  lagllgapfgrvdasdllg..kyvgelsgglrqrlarall..............................
00473941   1/1  lagllgapfielsasdllg........esdlrggfkqaa...............................
00490531   1/1  GKTtlaralakelargdvpevlvgvpvieinassll.fGskyvgefeealr...................
00406781   1/1  lagelgvpfvrisasellg..kyvgelsgglrqrlalaraa.............................
00386741   1/1  lagelgapfvrlda........................................................
00394721   1/1  lakelaagsgpilldgvpvvrldlsellsvsdlvgelegglrglltealal...................
00437901   1/1  akalakelgapvieidaselrd................................................
00527261   1/1  lakelgkpviyidlselsskgyv..dleellrela...................................
00503741   1/1  tLakllagllkpkfgei..llfgkvvyvnvselldlkellrll...........................
00416171   1/1  lakllprsgvpfvrvncsalte................................................
00494911   1/1  lanellrlgvlglpfvrvnasellealllsdlfgellgallralfellrgalela...............
00476651   1/1  alanelgrpfvpvallcfvrvncaallelsasdll...................................
00474201   1/1  GKTtlaralanelprslpglpfvrvnasdltdvglleellgkllgaat......................
00462581   1/1  pGtGKTtlaralakelglpfvrinasdll.vgllvgelegrlrglfteav....................
00437921   1/1  ralarlllgsgggvdvieldasdlrgvddlreligevlqalglllgg.......................
00497571   1/1  llslldvlrpkvdfddii.leeakeelllellelplklpelfkrlglkapkrrgvlLyGppGtGKTllak
00437941   1/1  laglllptsggvrvlgidaselld..............................................
00379961   1/1  lagllppdsgrivlvgnlsdlldpkdlre.........................................
00470731   1/1  TTlaralakelgagfilidgddlrekavgeleklgrdlfqvareg.........................
00512891   1/1  lagelgakfgsvsltgrdvrsarrgigyvfqtveellgllaelvglevrgeleell..............
00468261   1/1  pagsGKttilrllakllsenngvpvflinlgeltktaillklllsal.gfk...................
00404191   1/1  lanelkkrggrvlyvsa.....................................................
00482661   1/1  edenaaaflksnrqkklvrdladrviaeerlellekiieellrirldklledldeiveelppvlfddlvg
00457171   1/1  alakellglnflsvslselcskcv..geseglhpdlfllape............................
00519581   1/1  Lakllglpliidldalaellfgdvgglvvdli......................................
00477721   1/1  aLaeelglpfidtddllrelvgegielilelfd.....................................
00496061   1/1  Laerlglpvistddllreevepggtdlg..........................................
00472911   1/1  Laellgapfisgddllrglageggkplgllfedaleagfr.......qrladlirallakg.kvvil---
00437981   1/1  aralagllgpdsgk........................................................
00478391   1/1  laerlglpvidgddllrelvgeggrlgrdlfdedrllfrellideidl......................
00516041   1/1  laeelglpfvvidaddl....lrgeelgriielfde----------------------------------
00501941   1/1  laeelglpfidaddllrelvges.......irelfeaagrlaprellldeidellekggivildgfll--
00493981   1/1  aLaeelglpf..idaddllr.elvgegigllfe-------------------------------------
00459701   1/2  aLakrlgekgvkvvvidtddlrr.........eaikqliglglfdedgegalrrreavakllldall---
00479331   1/2  aLaeelglpfi...............dtddllrklvgesirellelagelaprillldeilell------
00499331   1/1  KtTlakaLaerlglpfidtddllrepvigagtdigevfqdlllaggllvddevrrlllealdellla---
00477561   1/1  raLakrlaelgkgvvvidtddlrr...alifqdeldlfdedreegfrvpeelvrellkellarllae---
00491901   1/1  kaLaeelglpf..idtddllreaklggelaeliedlfvprelli--------------------------
00515351   1/1  raLaerlglpvistddllreavpg.gtdigelfqdyllfpfltvdenirglllealeellaag.kvv---
00489631   1/1  Laellglpfiridgddllrellgellgrgig---------------------------------------
00533151   1/1  Laerlglpfistddllrelv.pggldigevfqdale----------------------------------
00515801   1/1  Laerlglpfistddllreavpggtplgeeirdlldagell------------------------------
00512061   1/1  Laerlg.glvvidtddllrea...gkirelfgflgelvfralelgllldeiekllakgkvvildgtllgt
00489391   1/1  TlakaLaerlglpvistddllreavpg.gtdlgelf----------------------------------
00487061   1/1  lakaLaer.gargld-------------------------------------------------------
00461621   1/1  lLaerlglpfistddlyrevvergtel-------------------------------------------
00480501   1/1  laellg.gvvvidgddlrralvggl.............................................
00486921   1/1  Laerlglpfistddl.lreavpggtdlgelfq......................................
00493061   1/1  Laerlglpvistddllreavpggtelgeyirdlfdeggllllaevrelllevleealaag..gvildgfp
00464591   1/1  Laerlglpfistddl-------------------------------------------------------
00478081   1/1  Laellkplgg------------------------------------------------------------
00513251   1/1  laellgfilidaddlr......................................................
00381441   1/1  Lagllppdsgsigslttrlprlgevdgvdltflsreeigyvfqepallpdltvlenlylgll--------
00451571   1/1  aklLakllglivldgddllreaiglvtqdgelll.elidegilvpdeiviellrealeeldad-------
00457851   1/1  kaLaerlglpvistd-------------------------------------------------------
00486891   1/1  Laerlglpvi------------------------------------------------------------
00478131   1/1  lLaellkplg------------------------------------------------------------
00518511   1/1  Laeklglpfi------------------------------------------------------------
00476071   1/1  lLae.lglpvidtddltregvllggpllerirel------------------------------------
00532471   1/2  lLaellnglggi.vsvdd----------------------------------------------------
00457881   1/1  Laerlglpvi------------------------------------------------------------
00498811   1/1  rlLae.lgvividgddltrelvaggglliglif-------------------------------------
00499191   1/2  lLaellgatvgd----------------------------------------------------------
00426051   1/1  kllakelglefidsgdilrdgvdlggesglll--------------------------------------
00363171   1/1  iealleglekgkknvllvgptGtGKTltaaalaaelgkpvliv.aptkeladqlyeelkkllpelkvell
00482721   1/1  lLae.lglpv------------------------------------------------------------
00493171   1/1  lLaeklglivlsvgd-------------------------------------------------------
00469161   1/1  Laerlgltglsv----------------------------------------------------------
00420081   1/1  Larhlgptggrvl---------------------------------------------------------
00475381   1/1  Lagllkptsgivsvdglrlavlsrdllgllregl------------------------------------
00483811   1/2  Lak-------------------------------------------------------------------
00529311   1/1  GvGKttlaralakallcefielnpclecnsc.......................................
00496571   1/1  rlLagllggsvldtgepirgeplgelir.glvfqdpllldeltvlenlalgrylhl.glilaal------
00462761   1/1  ialvGpsGsG------------------------------------------------------------
00480441   1/1  Laellpglivisvgd-------------------------------------------------------
00493431   1/1  lagllgptsgvisvggttreprpgevrgigyvfqsgalfphliva-------------------------
00487021   1/1  lLaell..gvvvidtddllrage-----------------------------------------------
00513761   1/1  laglladggkvlvidlDparanlpeqlgidirdlidletvmelglgpngalvfa................
00464411   1/1  aklLagllgptg----------------------------------------------------------
00503561   1/1  lleldelllelieleellkelleeilvellkedlelvlderrlyleeleldelglaellkelleeleide
00508671   1/1  vivlvGpsGs------------------------------------------------------------
00471271   1/1  allg...gdfaevgptpgtTr-------------------------------------------------
00414121   1/1  llglleglkvaviepdfgeilidgqlledlgvlavrlgigy-----------------------------
00457311   1/1  arllagllekpgsgv.......................................................
00509891   1/2  Larllkarglkv----------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RTSESKVGFANEPAEDAASKKEKENKTREIFRKKIQNGELDDKEIEIEVAVAPKTIGVMGPPGMEDMTSQ
00379261   1/1  p...gyvgyglgglltea........vrrlpysvllldelekahrpirvlllsaslvlllgglglpevge
00368501   1/1  p...........gyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallggg...
00418301   1/1  ......................................................................
00444381   1/1  ......................................................................
00402381   1/1  ......................................................................
00430121   1/1  ......................................................................
00521551   1/1  ......................................................................
00402371   1/1  ......................................................................
00367291   1/1  ......................................................................
00420941   1/1  ......................................................................
00392701   1/1  ......................................................................
00473941   1/1  ......................................................................
00490531   1/1  ......................................................................
00406781   1/1  ......................................................................
00386741   1/1  ......................................................................
00394721   1/1  ......................................................................
00437901   1/1  ......................................................................
00527261   1/1  ............................eelgellellkkllkklsellglsilglelilglsggdleel
00503741   1/1  ......................................................................
00416171   1/1  ......................................................................
00494911   1/1  ......................................................................
00476651   1/1  ......................................................................
00474201   1/1  ......................................................................
00462581   1/1  ......................................................................
00437921   1/1  ......................................................................
00497571   1/1  alakelgrlpfirvn.......................................................
00437941   1/1  ......................................................................
00379961   1/1  ......................................................................
00470731   1/1  ......................................................................
00512891   1/1  ......................................................................
00468261   1/1  ......................................................................
00404191   1/1  ......................................................................
00482661   1/1  qeeakeallenlklflkgpellldl..glpkgrgllLyGPpGtGKTtlakalanelggpvi.........
00457171   1/1  ......................................................................
00519581   1/1  ...............................................................dleaver
00477721   1/1  ......................................................................
00496061   1/1  ............................eifqalllagellfddevlgll....................
00472911   1/1  ----------------------------------------------------------------------
00437981   1/1  ......................................................................
00478391   1/1  ......................................................................
00516041   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00512061   1/1  eq--------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00480501   1/1  ......................................................................
00486921   1/1  ......................................................................
00493061   1/1  rtiesaealralllelglppdlvifldappevlleRllkRgdseevieerlerllrllerllelykeadd
00464591   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00513251   1/1  ......................................................................
00381441   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00363171   1/1  hggldylq..............................................................
00482721   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00529311   1/1  ......................................................................
00496571   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00513761   1/1  .............................................leellttldillealell.eedydy
00464411   1/1  ----------------------------------------------------------------------
00503561   1/1  klldkilddlegilplnpeQkeaieail...kgrvvliqGppGtGKTtlalaliaellkel....kgkgk
00508671   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00457311   1/1  ......................................................................
00509891   1/2  ----------------------------------------------------------------------
00459702   2/2  ---------------------------------------------------MpkvillvGppG-------
00532472   2/2  ---------------------------------------------------pGkiIvitGpsG-------
00479332   2/2  ---------------------------------------------------apkli.ltGppG-------
00509892   2/2  ----------------------------------------------------pkvigitGpsG-------
00483812   2/2  ----------------------------------------------------PkvillsGpPG-------
00499192   2/2  ----------------------------------------------------kgkiigitGps-------


                         -         -         -         +         -         -         -:280
query           LQDLFSSLSTDKKKNKKMRIKDAIKLAQDEEAAKLVNEEDIKARALEAVEQNGIVFLDEIDKVCRKSSNS
00379261   1/1  lllellddvgltdllgrtvdfkntiiiltsnvgelsggqrqrvalarallaepgilflDEiDklagkrgg
00368501   1/1  ...............relrdgellkalkeaeaeellellglkdlllrkpsqlSgGqkqRvalaralladp
00418301   1/1  ..........................................gigllaladpgvlflDEidkllpargss
00444381   1/1  ......................................................................
00402381   1/1  ......................................................................
00430121   1/1  ......................................................................
00521551   1/1  .............................................lalaraanpgvlflDEidklapkrs
00402371   1/1  ...................................................laraa....kpgvlflDEi
00367291   1/1  ...................................................pgvlflDEidalagkrg.s
00420941   1/1  .........................................lara....akpsilllDEidklapkrspt
00392701   1/1  .................................................akpsvlllDEidklapkrspt
00473941   1/1  ..................................................kpgvlflDEidrl.......
00490531   1/1  .............................................................rlfgeaeka
00406781   1/1  ..................................................dpgvlllDEidalldarsgs
00386741   1/1  ................................selsggeklrgllaralakpgvlllDEidal....dpd
00394721   1/1  ...........................................................akpsvlflDEi
00437901   1/1  ........................................vddlsgyvgelsggeklrellaealteavl
00527261   1/1  leelaellkklgkpv......................................ililDEiqsll......
00503741   1/1  ................................lealglpppyqlsggerlrvalaeallalgkpdllilD
00416171   1/1  ...................dlleselfghekgafgggekqrlgllrla.....dggvlflDEidkl....
00494911   1/1  ............................................................kggvlflDEi
00476651   1/1  ........................................eselfgeekeaflgallerlgklalagggt
00474201   1/1  ...........................................................fllakpgvlfl
00462581   1/1  ...........................................................lanpgvlflDE
00437921   1/1  .........................................................kpdvlllDEidrl
00497571   1/1  ......................................................................
00437941   1/1  ....................................pselsggerqrvliaralladpkvlllDEidal.
00379961   1/1  .......................................................llragiplvflnfaa
00470731   1/1  .............................................................glvpdilfi
00512891   1/1  ................................................ktlikelsggekqrvalarall
00468261   1/1  .....................kkslagtidalrklltealgk......................tdrptv
00404191   1/1  ...............................delvsklsgglqeqrvaiafalarkpdllllDEidal..
00482661   1/1  ......................................................................
00457171   1/1  ...................................................nspsiifideidallekrs
00519581   1/1  hlldi........................................aeellengeilildeptv.......
00477721   1/1  ..............................................rarfrkllielldellaa......
00496061   1/1  ......................................rerldelielllaggvvildgf..........
00472911   1/1  ----------------------------------------------------------------------
00437981   1/1  ....................................illdgkdirrgiglvfqliglfphltvlelvalg
00478391   1/1  ...............................................llakgkvvildgt----------
00516041   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00480501   1/1  ....................idgllilfledeaals..elvlevllealegggnpdvvil----------
00486921   1/1  ..............................................elllegellfrdelldllle....
00493061   1/1  lividaslsieevveeile---------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00513251   1/1  ....................................gqkqrvalleaalkegylvvvDe-----------
00381441   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00363171   1/1  ......................................................................
00482721   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00529311   1/1  ..............................asligiddirelieflslspllg.......krkvliidea
00496571   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00513761   1/1  iliDtpGglelrallalllaiaralaadei----------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00503561   1/1  rilvlaptraaaeqlaerlkkllgklvlllvlalllgvevgtlh.................---------
00508671   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00457311   1/1  ......................................................................
00509891   1/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GADVSREGVQRDLLPLVEGSTVSTKYGVIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIE
00379261   1/1  ggtnrldeevlnaLlelleelqvtgeyitvksdvtviaatnrpeeldpallrpalldRfdlvielplpde
00368501   1/1  gvlflDEidklldargssggdesrervlnaLlelleggevlsnvtviaatnrlliaigafeflkadeldp
00418301   1/1  ggdvsredvlnaLlrlleegeltilgggvdlpnvlviaatnpdlyrpdeldpallrRfdlvielplpdle
00444381   1/1  ....dpgilflDEidkllddrgeaegggdvsregvqnaLlrlleegellitggggrikvfsnvtviaatn
00402381   1/1  ..kapggvlflDEidkl............dpdvlnaLlqvleegeltdlggrivdlpnvrviaatnpgle
00430121   1/1  eaarkappsvlllDEidkl............dpdvlnaLlqlleegevtdlggrvvdlsnviviattnpg
00521551   1/1  ptsglddvsrrrvlnaLlrllegle........dlsnvlviaatnr....peeldpallrpgRfdlviel
00402371   1/1  dsllgarg..gsgvdpe.vqnaLlrlleeg...........nvrviaatnrpelvklgeldpallrRfd.
00367291   1/1  gtsrldpevqnaLlrlleelrv........lsgvlviattnr....peeldpallrpgRfdlvielplpd
00420941   1/1  saldadvrrevlnaLlrlldglq........alsnvtviattnr....peeldpallrpgRfdlviefpl
00392701   1/1  sgldvelrrrvlnaLlrlleglr........llsgvtviattnr....peeldpallrpgrfdriieldl
00473941   1/1  .....drevqnaLlelleelqvtilggglvvvelllllpsgvlviaatnr....pelldpallsRfdlvi
00490531   1/1  nggviLflDEidklagarg...sggspd.vqnaLlrlle............rgnvrvIaatnrpellk.f
00406781   1/1  gsggdsssrrvlnaLlrlleelr........llsgvtviatt..n..dleeldpallrpgrfdrvielpl
00386741   1/1  vqeallelleegeltivgggllteldglllpsgvlviattnr....pelldpallsRfdlvielpppdee
00394721   1/1  drlldar....dsesslevlnaLlrlledg...........nvlviattnrpellgrleldpallrrfdv
00437901   1/1  kgkpsvlllDEidal............dpdvlnallklldglr........dlsgvliilttn....dpe
00527261   1/1  ..dvsskelleaLlrllde...........gknvtiiltgsdlglldelllrpdlksplygRfdeiielk
00503741   1/1  Eitnlldpetl......spdvlelLlrlleegkltdkl....lgltliltthdldlle..rladrllsrf
00416171   1/1  ........dpdvqnaLlrvleegeltrlgggivlpadvrliaatnpdllelvlegelrpaLldRfdv.ie
00494911   1/1  drl............spdvqnaLlrllee.........lpsnvrviattnrpel.....ldpallsRf.l
00476651   1/1  vlflDEidkl............dpdvqnaLlrllee..........ppsnvrvilttn....rpekldpa
00474201   1/1  DEidkl............dpdvqnaLlrlle..........elpsnvrviattnrpl....eldpallsR
00462581   1/1  idrlplkrqagg.dllrallea.lltlld........glislpsnvrviaat....nrpeeldpasllrR
00437921   1/1  ............dpdaqnallklleel.........pagvtlilttnrle.....ellpallsrfd.iie
00497571   1/1  ......................................nlrdlfelar....dpgilflDE.dklapdrq
00437941   1/1  ...........dpeaqnaLlklleel..........pkgvtvilttnr....leeldpallsRfd.vief
00379961   1/1  lpasllesellsggerqrvalaralalrpGllvlAdggvlllDEpdal............dpevqaaLlr
00470731   1/1  deidallrkgpdvildgagrtpeqlealldllee...........lgrpvvviiltt...nrevlldral
00512891   1/1  akpdvlllDEidgl............dpdvleallelleelk........rsgvtvilttndldel.ela
00468261   1/1  lvlddidll............dnevlaaLldllddl..........seidcsgisfiltsnpsdl..lrs
00404191   1/1  ........gldpelqeellelldel........aergvtlilttn.nrpeeldqallrllsrldrvivld
00482661   1/1  ........................................elnaseer...lkdllerllg.........
00457171   1/1  ltpleggrkvviideadrlteeaanaLlktle........ep..psnvlvilt....tnrperldpalls
00519581   1/1  ......................................................................
00477721   1/1  ........................................................ggvvldlgrtlllr
00496061   1/1  ..................................................pldlegalllrealarallp
00472911   1/1  ----------------------------------------------------------------------
00437981   1/1  lggilveevrellkellsgGqkqrvaiaralagdpkvlllDEptal............dpdaqnaLlkll
00478391   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00486921   1/1  ...vieellaag.gvildgfplslegaqalra......................................
00493061   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00363171   1/1  .............kealfpeidtlpykdaspneeidl.erlsallallegepdivvatvqalldlpkpel
00482721   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00529311   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00457311   1/1  ...................................................................ivi
00509891   1/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DFVRILREPDCSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLEKISF
00379261   1/1  eerleilklllekllkqyikllgeegvglelsdealealaeltegysgadreggaRellrllerllrdaa
00368501   1/1  aLlrRfdlvievplpdeeerleilklllkklelqlvdlselakltlglsdaaldllaeaaarlrlydeeg
00418301   1/1  erleilklllerllkrlaallglkklglklsdealealaelavrlrgyteggsardllnlleraaalall
00444381   1/1  rlfigggaflgleelverllglnligfgadvlsrlelslllllllvedllpgeldpallgRfdevielpl
00402381   1/1  elvklllgflaellkreveyagrgelppalldRfdliiefdppdleelleil....krllkkllkrlgek
00430121   1/1  legivellldllllgrlrelvedelrdrldpallrRfdrviefpppdeeelleil....rlllkkllkrl
00521551   1/1  plpdleerleil...........krlleklgle...sdealealaelt.......egfsardlrnllera
00402371   1/1  vielplpdleerleilklllekllkrl.........glelsdealealaels......yglpgarplvre
00367291   1/1  leerleil...........kllleklgls...sdealealaelteg.......fsarellnlleraaala
00420941   1/1  pdeeerleil...........kllleklgle...sdealealaelteg.......fsgrdlrnlldraaa
00392701   1/1  pdleerleil.............kllleklgleldddalellae........teggsardllnlleraaa
00473941   1/1  elpppdleerleil.............krllkkegvelddealellaela........ggsardllnlle
00490531   1/1  eldpallrRf.lvielpppdleerleilk....lllkkle.....lgegvelsdealealaels......
00406781   1/1  pdleerleil...........kllleklgle...sdealealaelteg.......fsardlrnllerala
00386741   1/1  erleilk.............rllkkeglelddealealaela........egsprdllnlleraaalall
00394721   1/1  .ielgpp---------------------------------------------------------------
00437901   1/1  eldpallrRfd.iiefpppdeeelleilkr.............ilekeglklddealealaels......
00527261   1/1  plsfeelleilkkl...........leelg....isdealekiyeltgGlprylellleellllalleei
00503741   1/1  ngkgivielpplseeelleilkkr...........lfeagvelvfddealellaelsarivkkcg..glr
00416171   1/1  ldlpsleerleilelllelllkrlaarlgle..glelsdealdllaey.......swpgnvRel------
00494911   1/1  vielpppsleerleilklllekl.............glelsdealealael.spgn.......prellnl
00476651   1/1  llsRf.lvielpppsleerleilklllekl.............glplsdealealaelsggnprellnll
00474201   1/1  f.lvielpppdleerleilklllekl.............glelsdealealaelspgnprellnlleral
00462581   1/1  fdviielplpldleerleilkll..................lelsdealealarlt.......pgkllyf
00437921   1/1  fkplseeelleilkr.............ileeegvklsdealealaels........ggdpraalnller
00497571   1/1  ak............llrvldggvntllrkgdgvvdlsnviv-----------------------------
00437941   1/1  pppdeeelleilk.............lilkkeglklddealellaels........ggsprdaln-----
00379961   1/1  lleegevtieragitlllpagvtviaatnddlg............eldpalldRfdlvielgplr-----
00470731   1/1  rRpgrllldepeldppdreerleilkrl.............lkklgtvldvthddelarladr..gtlvl
00512891   1/1  driallrr--------------------------------------------------------------
00468261   1/1  lspallsrlgvveielpayteedileiikrlleglklpsn...........fpevvieelvelaadvisd
00404191   1/1  lppdleergeilkrlaekl.............glplsdevlellaert.........gngrelin-----
00482661   1/1  ................................psvlvlDeidklfpdgksldskalk.gvldallnll--
00457171   1/1  Rc.rvielplpdeeerleiL................leklp..ldddvlealael---------------
00519581   1/1  .............................gldskd.ildelakilkevnfelifithded.elrerialr
00477721   1/1  ralrellreldl...........vvfldapleelleRllkR.ggrfdllielplleelkeilrellplyk
00496061   1/1  dlvifldap.leelleRllkrgrllereddseevlekrlerylelyerliepykkadyvividasg..s-
00472911   1/1  ----------------------------------------------------------------------
00437981   1/1  eela.........kgvtvilathdls.....ellpallsrcq.virfpplseeelleil.........dr
00478391   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00486921   1/1  ............llrelgldpdlvifldappevlleRllkr.....grpddseeeilerlerlreeyepl
00493061   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00363171   1/1  lll-------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00529311   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00457311   1/1  dgddlyklsreelrklrrrigmvfqdpalflnpgltvrenlaeplrllklgkkllepvglpevldryphe
00509891   1/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           DAPELVEKNINITTDYVNEKLGNLVKNKDLSQYIL-----------------------------------
00379261   1/1  ldaldeaggrvvitledleealgkvlpsldkslie-----------------------------------
00368501   1/1  gaRellrllerllllaladriavleggkviteedv-----------------------------------
00418301   1/1  ellllgdgrvvitledleealelilpsldksglel-----------------------------------
00444381   1/1  pdleerleilklllekllkrlvdllgl-------------------------------------------
00402381   1/1  vvglelsdealealaela.....ytyggslRdllnl----------------------------------
00430121   1/1  alkgegle--------------------------------------------------------------
00521551   1/1  lllalle......grvvitledlee---------------------------------------------
00402371   1/1  lenlleralalallrlllkggevitle-------------------------------------------
00367291   1/1  llegre......vitledleealekvlpsrlkld------------------------------------
00420941   1/1  lallegrevitpedllealelllvlkligsel--------------------------------------
00392701   1/1  lalle......grevitledle------------------------------------------------
00473941   1/1  raaalalle......grdvitledveea------------------------------------------
00490531   1/1  dg--------------------------------------------------------------------
00406781   1/1  lalle......grvvitledleealekv------------------------------------------
00386741   1/1  e......grvvitledveealglvlpsr------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00437901   1/1  ..egsprdllnlleraal...........-----------------------------------------
00527261   1/1  leilledvkk------------------------------------------------------------
00503741   1/1  laldllrralelaelegwe.....----------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00494911   1/1  leraallalleg----------------------------------------------------------
00476651   1/1  eral------------------------------------------------------------------
00474201   1/1  llall-----------------------------------------------------------------
00462581   1/1  nvrellnlleisleldpee---------------------------------------------------
00437921   1/1  aaa...........grelitled-----------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00470731   1/1  iaale..---------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00468261   1/1  eyvnllvrdlldvisraleladlr...-------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00457171   1/1  ----------------------------------------------------------------------
00519581   1/1  aeeldkdglleelrklldlidkydalkvdtdal-------------------------------------
00477721   1/1  .eladlvidtsglsleelvelileal--------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00437981   1/1  ilvleggkl-------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00486921   1/1  leeyddavvvidadgsieevveeilell------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00529311   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00457311   1/1  lsgGqr----------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------