[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD31100.1


[Show Plain Result]

## Summary of Sequence Search
   1::248
   1::182  8.7e-33 36.4% 0041533 00415331 1/1   e-binding domain                        
   7::182    1e-23 35.1% 0045002 00450021 1/1   e-binding domain                        
   7::183  2.9e-23 32.0% 0050060 00500601 1/1   e-binding domain                        
   3::182  5.7e-21 30.2% 0042338 00423381 1/1   e-binding domain                        
   7::171    6e-20 31.3% 0044877 00448771 1/1   e-binding domain                        
   1::248


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTFQYINFKILEVSGVDTKKFLQGLTTADLNGLSIDNDILLTAFANLKGRIISLCFVKFISNEKLLLSVE
00415331   1/1  mpvhygsileehlavregaglfdlshrglirvtGpDalkfLqgllTndvlkla.pgqalyaaflnpkGrv
00450021   1/1  ------hlglirvsGpdalkfLqglltndvskla.pgrarytlllnekGrvlddlivyrlgedefllvvn
00500601   1/1  ------hmgkirvsGpdalkfLqglltndvsklk.pgrarytlllnekGgilddlivyrlgedefllvvn
00423381   1/1  --fDvshmgkievsGpdalafLqrlltndvskl..pgrarytlllnedGgilddltvyrlgedefllvvn
00448771   1/1  ------hrglirvsGpdalafLqglltndvskltkpgrarytlllneqGgvlddlivyrlgedefllvvn


                         -         -         *         -         -         -         -:140
query           QEVFENLLAWLKKYGMFSKVSFNPNDDYALFFTKTGFLNHDILTKGSLTSEMTFEQVRKENIINKLATIN
00415331   1/1  lddlivyrl.gdglllvvnaglaeallkrLkkyalrskVeiedlsdlallalqgpkaaavlaslfldlpe
00450021   1/1  aalaeallawlkkyllrskvtvedvsddlallalqGpkarevlaklldadlsdlpffsvaettvagvdvl
00500601   1/1  aalaekllawLkkylllllllpgldVeiedvtddlallalqGPkarevlakllgadlsdlpffsfaeltl
00423381   1/1  aglaeallawlkkyllqlespgldvtvedvsddlallalqGPkarevlakltdadlsnealpffsaaevt
00448771   1/1  aalaekllawl.kyalrlkvtiedlsdelavlavqGpkarevlakllgddlsdlpffslaeltiagvpvl


                         +         -         -         -         -         *         -:210
query           AANFEKFLPAELDLDNVDKVVCYTKGCYMGQEVIARMHYKAKLKKELAVVKSESDIDDFDLKDSEGKPLA
00415331   1/1  llltvlgvgllilrdgrtgelgfelivpaedalallealleg----------------------------
00450021   1/1  vlrtgytgelgfellvpaedalalwealleagkelglkpagl----------------------------
00500601   1/1  ggvpvlvartgytgelgyeiyvpasllllllllllllledala---------------------------
00423381   1/1  iggvpvrvlrtgytGelgyellvpaedalalwdaLleageel----------------------------
00448771   1/1  vlrtgytgelgfeilvpaedalalwdallea---------------------------------------


                         -         -         -         +         -         -         -:280
query           NVVNKVFVDNQCYMLVVFHKEASEQEYQLDDGKIITKC--------------------------------
00415331   1/1  ----------------------------------------------------------------------
00450021   1/1  ----------------------------------------------------------------------
00500601   1/1  ----------------------------------------------------------------------
00423381   1/1  ----------------------------------------------------------------------
00448771   1/1  ----------------------------------------------------------------------