[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD31135.1


[Show Plain Result]

## Summary of Sequence Search
   1::292
  16::130  6.3e-40 38.3% 0039240 00392401 1/1   2 domain of RNA polymerase sigma factor 
  20::130  1.7e-36 37.8% 0047881 00478811 1/1   2 domain of RNA polymerase sigma factor 
  46::129  1.1e-25 41.7% 0043329 00433291 1/1   2 domain of RNA polymerase sigma factor 
  34::127  6.2e-25 38.5% 0049406 00494061 1/1   2 domain of RNA polymerase sigma factor 
  33::134  9.5e-15 29.6% 0041988 00419881 1/1   2 domain of RNA polymerase sigma factor 
 193::290  3.4e-13 26.6% 0039239 00392391 1/1   3 and sigma4 domains of RNA polymerase  
 221::290  1.8e-11 31.4% 0049695 00496951 1/1   3 and sigma4 domains of RNA polymerase  
 234::290  1.8e-10 38.6% 0049651 00496511 1/1   3 and sigma4 domains of RNA polymerase  
 218::290    1e-07 19.7% 0049224 00492241 1/1   3 and sigma4 domains of RNA polymerase  
   1::292


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MANKKLLPATKTKTLPVVSDNNLSAYLNFVNTLPVLSLEQEQELARRYKYKKDLDAAQQLVLSHLRFVTK
00392401   1/1  ---------------lglsddpvrlYlreigrvplLtreeeielakrieeglrlvllaiaelpltvdlil
00478811   1/1  -------------------ddpvrlYlreigrvplLtreeEielakrieagllelllalaalplaldlll
00433291   1/1  ---------------------------------------------lrlakagdleareklieaylplVvs
00494061   1/1  ---------------------------------vllsleeilallkelekllreaerakeelveanLRLV
00419881   1/1  --------------------------------mpllseeedeellaraqk.gdeeafeelverylpllyr
00392391   1/1  ----------------------------------------------------------------------
00496951   1/1  ----------------------------------------------------------------------
00496511   1/1  ----------------------------------------------------------------------
00492241   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IARNFSGYGLSIADLIQEGNIGLMKAVSKFDPDQGVRLLSFAVHWIKAEMHDYVLKNWKIVKVATTKAQR
00392401   1/1  elyellvaeelrlsdllsllldlelglepsllelalaleeellllellldgdeaarekli----------
00478811   1/1  allekllallllllellkelllllllleallalpaleleeelllleralegdeeareeLi----------
00433291   1/1  iakrylgrlpsgldleDliqeGligLlkAierFdpekgvkFstYavlwirgaildylrd-----------
00494061   1/1  isiAkkytnrGleflDLiqeGniGLlkAvekFdyerGykFsTYAtwWirqaitraia-------------
00419881   1/1  larrllgd.adaeDlvQevflrlwraldkfdp..gssfstWlyriarnlaidylrrrkrrvrlp------
00392391   1/1  ----------------------------------------------------------------------
00496951   1/1  ----------------------------------------------------------------------
00496511   1/1  ----------------------------------------------------------------------
00492241   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KLFFNLRSSKDKIGWLSSENIKELAEELGVKEETVIEMEKRMCQGDASLDLPYTDDDGEQTSQQSLYLED
00392401   1/1  ----------------------------------------------------------------------
00478811   1/1  ----------------------------------------------------------------------
00433291   1/1  ----------------------------------------------------------------------
00494061   1/1  ----------------------------------------------------------------------
00419881   1/1  ----------------------------------------------------------------------
00392391   1/1  ----------------------------------------------------lpvgddddlelldllpdd
00496951   1/1  ----------------------------------------------------------------------
00496511   1/1  ----------------------------------------------------------------------
00492241   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KSSNIEHQVVQQDYYDNFKAIVKDVLSGFDTRTKDIIMSRYLLDNKATLQDLAAKYNISAERVRQIEEDA
00392401   1/1  ----------------------------------------------------------------------
00478811   1/1  ----------------------------------------------------------------------
00433291   1/1  ----------------------------------------------------------------------
00494061   1/1  ----------------------------------------------------------------------
00419881   1/1  ----------------------------------------------------------------------
00392391   1/1  dapspeelleaeel....rellleaLekLpererevlrlryGlldlegltleeiAeilgvsrerVrqies
00496951   1/1  ----------elleeellrelleealetLsererevlrlryGlldlegltleeiAevlgvsrerVrqiek
00496511   1/1  -----------------------eaLslLtererevlrlryglddgedltleeiaellgisrervrqiek
00492241   1/1  -------speelleleellelllealdkLpererevlllryleg..lslkeiAeilgisvgtvksrlarA


                         -         *         -         -         -         -         +:350
query           LAKLKKAIKNRS----------------------------------------------------------
00392401   1/1  ----------------------------------------------------------------------
00478811   1/1  ----------------------------------------------------------------------
00433291   1/1  ----------------------------------------------------------------------
00494061   1/1  ----------------------------------------------------------------------
00419881   1/1  ----------------------------------------------------------------------
00392391   1/1  rAlkkLrkll------------------------------------------------------------
00496951   1/1  ralkkLrkal------------------------------------------------------------
00496511   1/1  ralkkLrkll------------------------------------------------------------
00492241   1/1  lkkLrellee------------------------------------------------------------