[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD31158.1


[Show Plain Result]

## Summary of Sequence Search
   1::364
   2::205  8.6e-63 37.9% 0053000 00530001 1/1   uclease H-like                          
   1::194  1.3e-52 35.8% 0051397 00513971 1/1   uclease H-like                          
   1::169  1.9e-42 38.8% 0047793 00477931 1/1   uclease H-like                          
   3::166  7.2e-33 28.2% 0044818 00448181 1/1   uclease H-like                          
   3::170  1.6e-17 27.1% 0053015 00530151 1/1   uclease H-like                          
  10::169  9.5e-11 27.7% 0049035 00490351 1/1   uclease H-like                          
 189::253  5.9e-10 21.5% 0051395 00513951 1/1   like                                    
 191::253    2e-09 15.9% 0052999 00529991 1/1   like                                    
 185::291  6.5e-09 16.8% 0052226 00522261 1/1   like                                    
 282::364  4.4e-08 25.0% 0051396 00513961 1/1   like                                    
 206::253  1.5e-05 22.9% 0050708 00507081 1/1   like                                    
 197::253    3e-05 21.1% 0052492 00524921 1/1   like                                    
   1::364


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIINTNKQLNNVIEILKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKKLKEIFEDK
00530001   1/1  -lidteeeleelleelknakviavDtEtvslrtyrgklcLiQiatgdgvylidllalgedlelLkelled
00513971   1/1  ldytlvdteeeleelleelldakvvalDtEttgldpyrgrlvliqlatggeaylidllhlgdlaaLkell
00477931   1/1  plllddyelidtleeleelleelldakvvalDtEttgldpyrgrivliqlatgdgeavlinpghtdedla
00448181   1/1  --sdwidtlrflltllsgpkvvglDvEwvpsisgylskvallqlcsgnrcllidllvlpdepvvdyltrv
00530151   1/1  --iltleeleelleella.glvaldtettslnyhtaelvglalavggeayyiplahalvlealkplledp
00490351   1/1  ---------eallarlteaevvafdtettgldpmtadlvglalalggyvplahlelgl.........edd
00513951   1/1  ----------------------------------------------------------------------
00529991   1/1  ----------------------------------------------------------------------
00522261   1/1  ----------------------------------------------------------------------
00513961   1/1  ----------------------------------------------------------------------
00507081   1/1  ----------------------------------------------------------------------
00524921   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DILKIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLGFQTQSSLKTLLKEILDIEIEKESQFSDWRNRP
00530001   1/1  pnilKvghgakeDlevLqrdfgillvnlfDTqiaakllglg.rvgLaaLvekylgvkldKkeqlsdWrar
00513971   1/1  edpsilkvghnakfDlkvLardlgielagvfDtmlaayllgpglrhsLdalaerylgveldkgeqlsdws
00477931   1/1  dalsldevleaLkelledpgilkvghnakfDlkfLar.lgielpgpvfDtllaarlldpglkshsLddla
00448181   1/1  sgireeslklatktlllllrlvkllddvpkdLlrlLadpsvlkVGvglseDlkkLkldhgleianllDlr
00530151   1/1  kipkvghdaKydlvvLar.lgielkgvafDtmLaaYLldPsrsshdlddlalrylglelisdeevygkga
00490351   1/1  dvlkvghnaKydlvllarr.GielepldDtlLlaylldPg.shglddlaerylgheli............
00513951   1/1  ----------------------------------------------------------------------
00529991   1/1  ----------------------------------------------------------------------
00522261   1/1  ----------------------------------------------------------------------
00513961   1/1  ----------------------------------------------------------------------
00507081   1/1  ----------------------------------------------------------------------
00524921   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQELIEVQKTQFNSIENIHAKIGNIQKFDEKTQR
00530001   1/1  PLseeqleYAalDvhyllelydklleelleegllewlleesellllrvllkmepegiwldlkgls-----
00513971   1/1  arplseeqleyaalDalallrlyekllelleeegrlellleel.elplvrv..m----------------
00477931   1/1  erylgieldkserlsgwgarpltfddvdl-----------------------------------------
00448181   1/1  ilaadslgllllerlslkklveevlg--------------------------------------------
00530151   1/1  kqltfdlevlaeyaaedadatlrlaevlle----------------------------------------
00490351   1/1  .......yaaedAlvtlrLlevlkprLee-----------------------------------------
00513951   1/1  ------------------------------------------------vdpedawlrikgavrlsprqla
00529991   1/1  --------------------------------------------------pedawlrlkgrsrlsprqla
00522261   1/1  --------------------------------------------ktllvdpeeaylrikgawrlnprqla
00513961   1/1  ----------------------------------------------------------------------
00507081   1/1  -----------------------------------------------------------------eldla
00524921   1/1  --------------------------------------------------------llllarlldprdla


                         -         -         -         +         -         -         -:280
query           NAILIAQWRETIAQEKNIPVRFIFNNKILYTIAHINPKSLNSFEHSELKSLKPWIKKGVVTALNSSKSLD
00530001   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00448181   1/1  ----------------------------------------------------------------------
00530151   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00513951   1/1  vlkaLaawReelArerdvppgrvlkdaaLlelAealPrsleeL---------------------------
00529991   1/1  vlraLlewRdelArerdeppgyvlpdelLlelaealPtdleeL---------------------------
00522261   1/1  vlraLaawRdelArerDespgfvlpdslLlelAealPtsleeLlrllglvpplvrrhgdellelikeale
00513961   1/1  ----------------------------------------------------------------------
00507081   1/1  lleaLralRkelAreldvppyvifsdatLlelaellPttleeL---------------------------
00524921   1/1  lleaLralReelAreldvppyvvfsdktLlelAklrPttleeL---------------------------


                         -         *         -         -         -         -         +:350
query           QVTLEQTSGSKLSTELNDKIIDFFDTYTKQLKFDSSIIASRKDIRSLAYNLNIDTNYKNNKLLNGWRYEI
00530001   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00448181   1/1  ----------------------------------------------------------------------
00530151   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00513951   1/1  ----------------------------------------------------------------------
00529991   1/1  ----------------------------------------------------------------------
00522261   1/1  lpeddlPelld-----------------------------------------------------------
00513961   1/1  -lrlpllpgykallkl...lkallkevaeelgvapellaskkdleqllswlwklkdedelpellsGWRre
00507081   1/1  ----------------------------------------------------------------------
00524921   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VGKKLKEYILSNTK--------------------------------------------------------
00530001   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00448181   1/1  ----------------------------------------------------------------------
00530151   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00513951   1/1  ----------------------------------------------------------------------
00529991   1/1  ----------------------------------------------------------------------
00522261   1/1  ----------------------------------------------------------------------
00513961   1/1  llgekllellkgel--------------------------------------------------------
00507081   1/1  ----------------------------------------------------------------------
00524921   1/1  ----------------------------------------------------------------------