[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD31166.1


[Show Plain Result]

## Summary of Sequence Search
   1::240
   4::242  6.8e-73 40.5% 0046520 00465201 1/1   e and uridine phosphorylases            
   5::239    4e-64 41.1% 0039496 00394961 1/1   e and uridine phosphorylases            
   5::240  5.5e-63 39.1% 0041801 00418011 1/1   e and uridine phosphorylases            
   5::239  4.9e-60 35.0% 0050186 00501861 1/1   e and uridine phosphorylases            
   5::237  2.8e-59 32.0% 0051743 00517431 1/1   e and uridine phosphorylases            
   4::240  3.8e-59 36.4% 0048860 00488601 1/1   e and uridine phosphorylases            
   1::239  4.8e-58 32.6% 0047738 00477381 1/1   e and uridine phosphorylases            
   4::239  5.8e-51 30.6% 0049568 00495681 1/1   e and uridine phosphorylases            
  18::234  1.9e-49 31.3% 0039819 00398191 1/1   e and uridine phosphorylases            
   5::239  4.2e-48 28.2% 0051268 00512681 1/1   e and uridine phosphorylases            
  17::240  9.4e-37 28.0% 0048936 00489361 1/1   e and uridine phosphorylases            
   4::239  5.4e-33 21.2% 0045902 00459021 1/1   e and uridine phosphorylases            
  15::239    2e-30 21.7% 0050047 00500471 1/1   e and uridine phosphorylases            
  18::239  6.9e-24 21.6% 0048112 00481121 1/1   e and uridine phosphorylases            
  14::239  2.2e-22 17.4% 0050257 00502571 1/1   e and uridine phosphorylases            
  16::241  9.6e-17 20.4% 0046099 00460991 1/1   e and uridine phosphorylases            
   5::240  3.4e-14 19.2% 0046908 00469081 1/1   e and uridine phosphorylases            
   1::240


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLLPTPHIETLRKEEFAKTVIMPGDPLRAKYIADNYLENVVRVNAVRNMFGYTGTYKGKKVSVMGSGMGM
00465201   1/1  ---ltphig.akkgdiaelvllpGdPlRakliAetflenaelvnevrelllytgtykgkkisvvstGiGi
00394961   1/1  ----tyHlg.lkkgdiakvvllpgdplrvkliae.llenaelvnevrgyliytgtykgkrvsvvshgiGi
00418011   1/1  ----mtyhig.akkgdiaevvllpgdplrvkliaetlldnvvlvnevrgyliytgtykgkrvsvvstgiG
00501861   1/1  ----ltyhlgakkgdvakiviiggdpervkllaellleevvlvtevrgflfytgtykgkpvvvvstgiGk
00517431   1/1  ----tyhlg.lkkgdiakiviiggdplevellaellldevelvldirgfpfytgtlkgkevvvvstgiGk
00488601   1/1  ---gltyhlglkpgdiakivilvgdplrvkllae.lledvelvadvrgfltytgtykgkkvsvvstgiGk
00477381   1/1  ledgllyhlglkpgdiglakiviiggdplrvkllae.lledvelvtdirgfpfytgtlkgkpvvvvstGi
00495681   1/1  ---tdaaaaverllelyersvkllrdalaalleggllpdedleerlravYPelrlttdgelaevdsrlaf
00398191   1/1  -----------------mkiviivAlpleakalae.lledve.vnevrgmlyytgtykgkevvvvltgiG
00512681   1/1  ----eeldlsldlltlhlglklgdiakivligglpleadalaelld......ieyrgiplytgtlggknv
00489361   1/1  ----------------lllesslllllelleeaaelildllgllkpkigiIgGsglgeladllldalvei
00459021   1/1  ---lllllelleeaaahikaklg.lvpkigiigGsglgdladaleeevetpygeipdfpvstveghsgkl
00500471   1/1  --------------lvpkiaiigGsglgvliiledipefpvstvaghpsgklvlgtlggkpvvflarhGr
00481121   1/1  -----------------lsllllekleeaadlllsklglrpkigiigGsGlgdladaleeevetpygeip
00502571   1/1  -------------llekleeaaelllsklglkpkigiigGsGlgdladaleeevetpyge.....ipgfp
00460991   1/1  ---------------kpkigiIgGSGlgdleilllleilyvetpfgphsgklvlgtlggvpvvflarhGr
00469081   1/1  ----lllekleeaadlilsktgllapkigiigGsglgdl..lelleevevetpygeipgfpvstvaghsg


                         -         -         *         -         -         -         -:140
query           PSMGIYAYELFKYYDVDNIIRVGSAGSYKAEFKVYDVVLIEESYCESNFIEIVTGSKTSDVRSSEELNKE
00465201   1/1  PsasiyveeLiallgvktliRvGtaGalqpdvklgdlviatgAvrlsglsrlyflgldypavadfellla
00394961   1/1  psaaivleeLi.lygvktiIrvGtaGalqedlkvgdvviataavrddgdtslfylplgqpypavadfell
00418011   1/1  kpsaaivleeLia.lgvkaiirvGtaGalqpdlkvgdlviataavrddgtsllylppldypavadfelld
00501861   1/1  psaaialeeliallgvkliiriGtaGaldpdlkvgdvviataavrhdgdsafgylpgevpavadpellea
00517431   1/1  vnaaialeeliallgvktiiriGtaGgldpdlkvgdvviataairldgtspgylpgvdypapadpellea
00488601   1/1  psaaivleeLi.llgvktiiriGtaGalqpdllkvgdvviataavrddgtsfgylpg.eypavadpelle
00477381   1/1  Gkpnaaiaveelia.lgvktiiriGtaGgldpdlkvgdvviataairldgtsfgylpgdvp.apadpell
00495681   1/1  GlvalpGvyattvtrPdlfrdylleqlglllrnygvpvevglsdteiPlpfaldggdlledgllalelrd
00398191   1/1  kvnaaiattelialfgvdliirvGtAGgldpdlkvgDvvvatgvvqhdvdatgfgyelgqfpglplafaa
00512681   1/1  vlvrtgiGkvnaaialreli.llgvkliirvGaaGglnpdlklGdvviaddaidydggsllvlgvefpap
00489361   1/1  pyetipgfpsltvkfhagt.l.....ggevrgvlarhG......ighlyegigvnaarani.ellkalgv
00459021   1/1  vtgtlggvpVvvflgrhGkyegaiptevnyranllkllgvetliatgaaGglnpdlkpgdlviiddhidl
00500471   1/1  ghlyephkvnyraniraLk.alGvktliatgaaGslnedlkpgdlvipddhidltggrpltffngggvrh
00481121   1/1  dfpvstveghsgklvlgtlggkpvvvflgrhGkyegaiptevnyranllkllgvdtliatgaaGglnpel
00502571   1/1  vstveghsgklvlgtlggkpvvlrhGrfhlyeghglvnaranvraLka.lgvetliatgaaGglnpdlkp
00460991   1/1  ghlyephkvnyraniralke.lgvetliatgaaGglnedlkpgdlviiddhidltgdrdltfligpnder
00469081   1/1  klvfgtlggvpvvf.rhGrghlyeghsvnyralniralkllGvevliatnaaGglnedlkpgdlvliddh


                         +         -         -         -         -         *         -:210
query           LIASAQRQDIELKKAKAHCTDVFYRKNSDDYKKIVKKYNCDLVEMETAALFATAAELGKKASAVVTISDS
00465201   1/1  lveaakelgikvhvGivlssdlFYagq.erllellkklgvlavemEaaaLftlaallglkalavltvsdn
00394961   1/1  dalveaakelglkvhvGlvastdsfyre.qerllkllkklgvlavEMEaaalaalaallgvkalvvltvs
00418011   1/1  alvkaaeelglkvhvGlvastdgfyret.eeklrllkklgalavEMEaaalaalaallgvpalailtvsd
00501861   1/1  llkaakelgikvhvGliastdgfyae.terllkllkkfgvlavEMEaaalaavaallgvpalailtvsdn
00517431   1/1  lleaakelgikvhvGviattdgfyae.teaelrllkklgalaveMEtaalaavAallgvpalairavsDl
00488601   1/1  alveaaeelgikvhvGvvvttdgfyretgrpeklellrklgalavEMEsaalaavaallgvpalailtvs
00477381   1/1  ealleaakelgikvhvGvvattdgfyretgrldglllsfpellpallrllrklgalaveMEsaalaavaa
00495681   1/1  lfdlpdLaliddeianGlllpgeplplalftalrvdlslarlehytgtavehfqnyvlltnyqfyvdefi
00398191   1/1  dlallkaalkaakelglkvhvgliasgdsfvadaea.rlellklfpgalaveMEaaavaqvAalfgvpfl
00512681   1/1  .adpellealleaakelgikvheGtiasgdgfyfetpaeirellrklgadaveMEaaalaavArelgipf
00489361   1/1  ktiirtGaaGglnpdlkpgdlviatdaidldgdstlf.gvrfpdladp..ldkalreaakelgikvheGt
00459021   1/1  tgdrdvtpligpnlerggvrfvdms.apydpelrellleaaeelgikvhlregvyvvvsgPrfe...tpa
00500471   1/1  vdmaap.ydpelrellleaakelgikvhvggvyvvvsgPrfe..tpaeirmlrselgadavgMttapeai
00481121   1/1  kpgdlviiddhidltggrtatfligpnlerggvrfvdms.dpydpelrellleaakelgikvhlregvyv
00502571   1/1  gdlvliddhidltggrpltgfndglfgvrfvdmsdpydpelrellleaaklregvyvvveGPrfe..tpa
00460991   1/1  ggvrhvdmadp.ydpelrellleaakelgikvhrggvyvvveGPrfetpae...irllrslgadavgMtt
00469081   1/1  idltggrpltgfn...fvdmsdpydpelrellleaakelreGvyvcveGPrf.etpaeirmlrllGadaV


                         -         -         -         +         -         -         -:280
query           FITGESTTAQQREQSFTNMMEVALGTIKEN----------------------------------------
00465201   1/1  lltgellsaeereetfnemievaleaallnkl--------------------------------------
00394961   1/1  dnllltgeittseelllafknmielllei-----------------------------------------
00418011   1/1  nlltgealsaeerlelflkmieialeallk----------------------------------------
00501861   1/1  alggealsfeefletvakmielalelllk-----------------------------------------
00517431   1/1  adgeealsfeefletaakasaialell-------------------------------------------
00488601   1/1  dnllggelvllfeefleeaaekaieialea----------------------------------------
00477381   1/1  llgvpalairvvsdnaltgellsfeefle-----------------------------------------
00495681   1/1  eltphilakpgd.iakiviipadpeevda-----------------------------------------
00398191   1/1  viraisDladeganldweeflala----------------------------------------------
00512681   1/1  lvirgvsDyadghenvdweevlaaaaaaa-----------------------------------------
00489361   1/1  yattdgfyfetp.aeirllrklgadaveME----------------------------------------
00459021   1/1  eirmlrllgadavgMstapeailArelgl-----------------------------------------
00500471   1/1  lArelglpyaaislvtdyaagieepvthe-----------------------------------------
00481121   1/1  vvsGPrfetpae...irllrllgadavgM-----------------------------------------
00502571   1/1  eirllrllgadaVgMstvpeailArelgl-----------------------------------------
00460991   1/1  vpeailArelglpyaaislvtdyaagldsde---------------------------------------
00469081   1/1  gMstvpeailArelglpyaaislvtdyaag----------------------------------------