[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD31313.1


[Show Plain Result]

## Summary of Sequence Search
   1::366
   1::363    7e-45 22.7% 0051981 00519811 1/1   lycosyltransferase/glycogen phosphoryla 
   3::363  3.8e-44 23.9% 0053131 00531311 1/1   lycosyltransferase/glycogen phosphoryla 
   1::363  6.8e-38 25.3% 0043452 00434521 1/1   lycosyltransferase/glycogen phosphoryla 
 179::344  3.3e-17 22.4% 0052623 00526231 1/1   lycosyltransferase/glycogen phosphoryla 
   2::364  2.1e-15 18.3% 0046716 00467161 1/1   lycosyltransferase/glycogen phosphoryla 
 164::367  1.4e-13 23.4% 0038341 00383411 1/1   lycosyltransferase/glycogen phosphoryla 
   1::366


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKRFVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKVYTLNLNKFNVLFVL
00519811   1/1  mkiililevapppkvGGaervvlelaraLakrGhevtvitpgyggllpllellvivvvllllllglvlll
00531311   1/1  --kIllvtpslppvgGvervvlelaralakrghevtvltpggggllepgvrvvrlpllrlp.lllrllll
00434521   1/1  M.killvtselpplikvGGlervvlelakaLaarGhevtvvtpgygglladlllllelivlvggrlllvg
00526231   1/1  ----------------------------------------------------------------------
00467161   1/1  -mKiliv...tgtrpeiiklaplaralkkrpghevtlivtgqhyglldqfleelgipidpdlplllggls
00383411   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FKYIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLNAKFSKFS
00519811   1/1  lllvllvllllllllllllrplllllldllllllllalllllalllrrekpDivhahdwlpgllallla.
00531311   1/1  llrlrrllrrlkpDvvhahsplpgllallaarll.giplvvtlhgllpll.lpgllsrllrlllrlllrr
00434521   1/1  vlrllldgvkvyrlpapplflrpglpyllpslydyldnalrfalfslaalrrlrrllrrekpDvvhahdw
00526231   1/1  ----------------------------------------------------------------------
00467161   1/1  lalltgrvliglakvlreekpDvvlvhgdtvstlaaalaakklgipvvhvea.glrtfdrysgapeelnr
00383411   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIARNHADKNIS
00519811   1/1  rllgipvvltiHgllplglpsllllgllllllllrllrlllrlalrradaviavSeftaeellklygvpp
00531311   1/1  adaviavsealaeellelygvppekivvipngvdldrfrpapdpelraalrerlglpedkpvilfvGrlv
00434521   1/1  hsglaalllklarllgiplvltiHglafqglfpllllsllglpallfglagllrrllrnllraalrradr
00526231   1/1  --------------------------------------vdlerfgp....dpdkpvilfvgrlvprKgld
00467161   1/1  ..rlidrladlhfapsefarenllkegipperifvvgnpvidalfklaekalrppllsrselleklgldp
00383411   1/1  -----------------------vipigidvdrfapladpevkervrelrgllggkklilgvgrldysKG


                         -         -         -         +         -         -         -:280
query           RFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLDLYLSTSKVEGF
00519811   1/1  ekivvipnGvdldrfnpapdkllakarlalrrklglppdkpvilfvGRlelprKgldllleAlakllkkl
00531311   1/1  prKgldlllealalllkrlpdvrlvivGdgplreelealaaelgledrvrflGfvs.dlaelyaaadvfv
00434521   1/1  viavSetyaeellrlylglglegllgvpaekivvipngvdtdlfnpapdpelpvnysadtlegklenkaa
00526231   1/1  lllealall....pdvklvivGdgplreeleelakllelglednviflgfvsdeelaelyaaadvfvlps
00467161   1/1  dkkvilvtghrrlnedkglelllealaellerlpdvrlvivghgntrgrle.likllglpdnvrllgplg
00383411   1/1  illlleAferllekypelrgkvvlvqvgvpsredgeeyeelraeveelvgrIngrfgslgltpvvyllgs


                         -         *         -         -         -         -         +:350
query           PNILAEAMLCEVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVMKKRMREYIINNFSI
00519811   1/1  lgpdvklvivGdgplreeleklakelgledrvrflGfvsdeelaelyaaadvfvlPSryEgfGlvllEAm
00531311   1/1  lpSryEgfglvllEAmaaGlPvvatdvgglpevvedgetGllveppgdpealaeailrlledpelrarlg
00434521   1/1  lrerlglpdddkplilfvgRlvpqKgidlllealarlle..pdvrlvivGdGplreelealaeelglpdr
00526231   1/1  lyEgfglvllEAmaaGlpviatdvgglpeivedgvtgllvdp..dvealaeailrlledpelrr------
00467161   1/1  yldllallaaadlvvtds.....GgvvlEamalGkPvvvlrdtgerpelv.dagtgilvgtdpeaiaeai
00383411   1/1  vsdeellalyraAdvflvtslregmnlvalEamacgtPddkgvlvlsefagaaevlgd.allvnpydvd.


                         -         -         -         -         *         -         -:420
query           EAILEKHEKLYHEGSV------------------------------------------------------
00519811   1/1  acGlPviasdvgG---------------------------------------------------------
00531311   1/1  eaareraee.fsw---------------------------------------------------------
00434521   1/1  vrflgfvsdeela---------------------------------------------------------
00526231   1/1  ----------------------------------------------------------------------
00467161   1/1  erllsdpelrerms--------------------------------------------------------
00383411   1/1  alaeaikraltmdpeer-----------------------------------------------------