[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD31359.1


[Show Plain Result]

## Summary of Sequence Search
   1::249
  11::247  2.3e-58 34.7% 0051682 00516821 1/1   mate kinase-like                        
  12::249  5.5e-58 34.2% 0051530 00515301 1/1   mate kinase-like                        
  12::247  1.4e-57 34.5% 0051265 00512651 1/1   mate kinase-like                        
  11::247  6.6e-57 34.7% 0052013 00520131 1/1   mate kinase-like                        
  22::246  3.9e-50 31.9% 0053112 00531121 1/1   mate kinase-like                        
  16::247  2.4e-48 30.8% 0052030 00520301 1/1   mate kinase-like                        
  16::249  3.5e-48 30.4% 0051788 00517881 1/1   mate kinase-like                        
  17::247  3.6e-44 29.8% 0053023 00530231 1/1   mate kinase-like                        
  16::249  3.5e-41 29.0% 0051807 00518071 1/1   mate kinase-like                        
  16::247  1.3e-40 31.5% 0053148 00531481 1/1   mate kinase-like                        
  15::247  6.7e-40 32.7% 0036708 00367081 1/1   mate kinase-like                        
  12::248  7.9e-40 29.7% 0052151 00521511 1/1   mate kinase-like                        
  14::247  3.2e-37 29.6% 0038241 00382411 1/1   mate kinase-like                        
  16::247  4.6e-28 27.6% 0052046 00520461 1/1   mate kinase-like                        
  15::246  7.3e-25 26.8% 0045891 00458911 1/1   mate kinase-like                        
  16::247  4.6e-20 26.5% 0052050 00520501 1/1   mate kinase-like                        
   1::249


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNDSSECSQKLPKLKRILLKLSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGG
00516821   1/1  ----------lllkykriVlKlGGsslagedgllldlerlkrlaeiiaelvelgvevvvVvgGgaiatgl
00515301   1/1  -----------llkykriVlKlGGsslagddgggldlerlkrlaeiiaelvdlgvevvvVvgGgvavggl
00512651   1/1  -----------llkmkriVlKlGGsslagedglgldlerlkrlaeiiaelvdlgvevvvVvgGgngvggl
00520131   1/1  ----------lllkykriVlKlGGsslagddglgldlerlkklaeiiaelvelgvevvvVvgGgngvtdl
00531121   1/1  ---------------------lsgevlvgvsvvlvssgalallakelkllldpreldalvagGevgsrgl
00520301   1/1  ---------------kriViKlGGsaladdg...ldlellkalaeiiaelle.gvevvvVvGGgpavgll
00517881   1/1  ---------------kriViKlGGsaltdkgg..ldlerlkalaeiiaelve.gvevvvVvGGgvavgll
00530231   1/1  ----------------riVvKfGGssla.......daerikkvaeiiallldlgvevvvVvsggggvtdl
00518071   1/1  ---------------llllsllelvkvlrealpyinkfrgkriViklGGsalt.......dlellkslae
00531481   1/1  ---------------kriVvKfGGssla.......daerikkvaeiiael...gvevvvVvsagggvtdl
00367081   1/1  --------------mkriVvklGGsaladeggllsagldlerlealaediaelvklGvevvvVhGggpqv
00521511   1/1  -----------mskliVlkfGGtsladaenvrkvadiilellegnrvvvvsalgkvtrillklggsaltd
00382411   1/1  -------------rmkriViklGGsalt.......dlellealakdiaellrslgievvvVhGggpqvgl
00520461   1/1  ---------------dllelvevlrealpyinafrgkriViklGGsalt.......dlellkalaedial
00458911   1/1  --------------gkriViklGGnaltdegg.gldlqlellealaediallravGievvlVhGGgpqvg
00520501   1/1  ---------------lelllsllelvevlrealpyinafrgktiViklGGsalt.......deellesla


                         -         -         *         -         -         -         -:140
query           RANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLI
00516821   1/1  llll.lgldprtldllgalaevlnalllaaaleklgvaavlltaidlgivteplnarralrllelgvvpi
00515301   1/1  llgl.lgldpatldllgalaevlnalllaaaleelgvaavlltaidlgivteylnaetllrllelgvvpi
00512651   1/1  llglr.gldpatldllgalaevlsalllaaaleelgvaavlltaidlllvteylnartllrllelgvvpv
00520131   1/1  llglrg.ldpatldylgalaevlnalllaaaleklgvaavlltaidllivteplnarraipllnegdvvv
00531121   1/1  laayllglgraaldlagilltvlnalilqralnaigtllrllslivvpgfng...............ndi
00520301   1/1  llklalrgldlatldalaavgegllalllaaaleklgvpavqlll............etllrllelgvip
00517881   1/1  llgl....rvtdldeldalaavgqgllnallvaaleelgikaaqllltdddlsvgrielvaretlltlle
00530231   1/1  llglakaallgvdalsllelleailgrhleileellldlllleellkllvellgllseflnglrvlgplt
00518071   1/1  diallrelgievvvVhGggpqvgdlllalgiepefvdglrvtdlatldvlaavgqgllnlllvaalenlg
00531481   1/1  llalaelalkgdllelldallarhlgiiselllglrvtdlllllllelvllgivlldeldlalldalaal
00367081   1/1  gnlllklgleasflg.ldrrpldllgaqalaaiglrltdaltlelvemvlaglvnkllvallvdlglpav
00521511   1/1  elalglaldvllalaqgiiglvhggglvilvvsgalgigrg.lllglrvvdeltldvldmlaavGellsa
00382411   1/1  lllklgllpefvnglrvtdaatldvlaavgqgllnallvdalnnlgikavgllgtdgdlltarrllnarg
00520461   1/1  lkelgievvvVhGggpqvgdlllklgiepkfvnglrvtdlatldalaavgqgllnallvaalnnlgltav
00458911   1/1  llllklgiasefvdparglrvtdaealaavgqvllgalnkelvalgldldvgllvaqvlvtaddllfklg
00520501   1/1  ediallkelgievvlVhGggpqigllllklgiepkfvnglrvtdaatldvlaavgqgllnkllvaalnna


                         +         -         -         -         -         *         -:210
query           FAGGTGNPFVTTDTTASLRAVEIGADALLKATTVNGVYDKDPNKYSDAKRFDKVTFSEVVSKELNVMDLG
00516821   1/1  vagfdglprgdsDtlAallAallgAdlllilTdvdGvytadPrkvpdaklideisydealelggmvlklr
00515301   1/1  vngfdglgrggsDtlAallAallgAdllliltndvdGvytadPrkvpdaklideisydealelggmvlkl
00512651   1/1  vagfdglgrgdsDtlAallAallgAdlllilTdvdGvytadPrkvpdaklideisydellelggmvlklr
00520131   1/1  vagftglgrggsDtlAallAaalgAdlllilTdvdGvytadPrkvpdaklidelsydealelggmvlklr
00531121   1/1  vgatttlgrgdsDtlAallAaalgAdlliilTdVdGvYtadPrkvpdaklideisyeealelasagsllg
00520301   1/1  vvagfdg..rgdsDtlAallAaalgAdlliilTdvdgvytadPrkvpdaklideisydellelaaggsil
00517881   1/1  lgvipivagfdgvpvgelgfgdsDtlAallAaalgAdlliilTdvdGvytadPrkvpdaklideisyeea
00530231   1/1  lavldallalGellsalllaaaleelgvkavqldltdadlvtdsrygnarvieevirellerllekgvvp
00518071   1/1  vtavgllgtdgdlvtakpignaysedgvdlgvvgeilpvdrelilrlleagvipvvagfggvptgelgng
00531481   1/1  GellsalllaallnelgvkavvldaaqvlltdedfldarivlnatevnletllalleagvvpvvaGfigv
00367081   1/1  glpgkdiglitaielaqalltaddlviredadlgyvgvvaspyprrivdtetikrllelgvipiiagggg
00521511   1/1  lllaalleelgvkavqldgrdaglvtasdlpdalglvgaieevirellktlleagvvpvvagfigvdvee
00382411   1/1  lvgvvesvdpetieallelgviPvvagnggvpvgelgngdsDtlAallAaalgAd.liiltdvdgvydad
00520461   1/1  qllgtdggllta.krlgnavdlgvvgeikpvdtetiealldagvipvvagfgggpvgelgngdsDtlAal
00458911   1/1  tkaiglsgkdgelilaeklgvvvvedagrgyrrvvpsprpvdlgavgtiktlldlgvipilnenggipvi
00520501   1/1  gltavgllgtdgdlitakpigpfyteeeagvvlgidlglvgrvvlvdtelletlldagvipvvagiggvp


                         -         -         -         +         -         -         -:280
query           AFTQCRDFGIPIYVFDLTQPNALVDAVLDSKYGTWVTLD-------------------------------
00516821   1/1  aallaleagipvvilngfnpgnlleillgeavGTlit---------------------------------
00515301   1/1  raallaaeagipvvilngfnpgnllrlllgeavGTlivp-------------------------------
00512651   1/1  aallaleagipvvilngfnpgnlleillgegvGTlit---------------------------------
00520131   1/1  aallaleagipvvilngfkpgnllralagegvGTliv---------------------------------
00531121   1/1  tggmvlklraaelaaengipvvvfngfnpgnlgtil----------------------------------
00520301   1/1  gtggmvlklraallaleagipvvilngrnpgnlleil---------------------------------
00517881   1/1  lelalaggsgsglgtGgmvlklraallaaeagipvviln-------------------------------
00530231   1/1  vvaGfiginenglvttlgrggsDtlAallAaalgAdl---------------------------------
00518071   1/1  dsDtlAallAaalgAdkliiltdvdGvytadP...pdak-------------------------------
00531481   1/1  nenglvttlgrggsDttAallAaalgAdlliilTdvd---------------------------------
00367081   1/1  vpvveeedgltgelanidnDtaAallAaalgAdllii---------------------------------
00521511   1/1  gelttlgrggsDtlAallAaalgAdlliilTdvdGvyt--------------------------------
00382411   1/1  pkllpdatlleaislieaelatggmkvkllaaveaar---------------------------------
00520461   1/1  lAaalgAdkliiltdvdGvyt.dpr......lideit---------------------------------
00458911   1/1  telgfgvlanidnDtlAallAaalgAdlLiilTdvd----------------------------------
00520501   1/1  tgellnidaDtlAallAaalkAdkLiiltdvdgvyda---------------------------------