[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ftul2:ACD31463.1


[Show Plain Result]

## Summary of Sequence Search
   1::1290
1029::1290 1.1e-89 44.3% 0049527 00495271 1/1    I glutamine amidotransferase-like      
 617::816    8e-64 40.5% 0043867 00438671 1/1   N-terminal domain-like                  
 220::429  3.8e-63 35.4% 0049528 00495282 2/3   N-terminal domain-like                  
 430::616  1.8e-61 37.4% 0049529 00495291 1/2   C-terminal domain-like                  
 427::656  5.7e-55 35.0% 0043869 00438691 1/2   C-terminal domain-like                  
 428::613  7.6e-45 34.1% 0044822 00448221 1/2   C-terminal domain-like                  
 621::817  2.7e-43 32.8% 0049528 00495283 3/3   N-terminal domain-like                  
 818::1029 3.6e-43 28.8% 0043869 00438692 2/2   C-terminal domain-like                  
   1::151  3.9e-40 43.0% 0043865 00438651 1/1   like                                    
 820::988  1.4e-36 32.7% 0049529 00495292 2/2   C-terminal domain-like                  
 185::428  7.1e-34 32.1% 0050216 00502161 1/2   N-terminal domain-like                  
1033::1261 7.7e-30 26.5% 0047949 00479491 1/1    I glutamine amidotransferase-like      
 819::985    1e-29 29.9% 0044822 00448222 2/2   C-terminal domain-like                  
 620::816  1.1e-29 29.4% 0050216 00502162 2/2   N-terminal domain-like                  
1032::1289 7.8e-26 24.9% 0050138 00501381 1/1    I glutamine amidotransferase-like      
 152::219  2.3e-20 51.5% 0049526 00495261 1/1   synthase PurL, linker domain            
1032::1258   5e-18 24.6% 0048482 00484821 1/1    I glutamine amidotransferase-like      
 201::428  5.2e-13 29.0% 0050217 00502171 1/2   N-terminal domain-like                  
1035::1291 1.1e-12 25.0% 0050645 00506451 1/1    I glutamine amidotransferase-like      
1036::1262 8.5e-09 22.4% 0047771 00477711 1/1    I glutamine amidotransferase-like      
1036::1258 9.3e-09 22.9% 0039782 00397821 1/1    I glutamine amidotransferase-like      
1035::1292 2.9e-08 25.9% 0047324 00473241 1/1    I glutamine amidotransferase-like      
1035::1268   4e-08 18.9% 0045752 00457521 1/1    I glutamine amidotransferase-like      
1035::1292 2.5e-07 24.5% 0047286 00472861 1/1    I glutamine amidotransferase-like      
1035::1145 2.8e-07 28.6% 0037903 00379031 1/1    I glutamine amidotransferase-like      
1032::1275 1.6e-06 19.7% 0049298 00492981 1/1    I glutamine amidotransferase-like      
1035::1289 1.8e-06 21.1% 0039988 00399881 1/1    I glutamine amidotransferase-like      
1029::1261 6.5e-06 20.1% 0042648 00426481 1/1    I glutamine amidotransferase-like      
1036::1145 1.5e-05 33.0% 0041867 00418671 1/1    I glutamine amidotransferase-like      
1039::1258 5.2e-05 21.1% 0051742 00517421 1/1    I glutamine amidotransferase-like      
1034::1258 0.00025 22.2% 0043181 00431811 1/1    I glutamine amidotransferase-like      
1034::1289 0.00043 17.1% 0042722 00427221 1/1    I glutamine amidotransferase-like      
 497::595    0.001 25.6% 0050292 00502921 1/2   C-terminal domain-like                  
 426::592     0.14 17.3% 0036051 00360511 1/2   C-terminal domain-like                  
 864::964     0.14 16.0% 0036051 00360512 2/2   C-terminal domain-like                  
 629::725     0.16 21.8% 0050217 00502172 2/2   N-terminal domain-like                  
 835::969      9.3 16.7% 0050292 00502922 2/2   C-terminal domain-like                  
 177::219       25 18.6% 0049528 00495281 1/3   N-terminal domain-like                  
   1::1290


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MITIFEGLSALSPFKREKILAAAKKISNKVESVSAQYIHVTELESELNSEQERIVKSLLNYNREYGIAQP
00495271   1/1  ----------------------------------------------------------------------
00438671   1/1  ----------------------------------------------------------------------
00495282   2/3  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00438651   1/1  vllillgasalsefrlekllerlekllpsvlsvsaeyvyfveleselsaeelelLlaLLsygpalellgp
00495292   2/2  ----------------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           MGHTFIIAPRVGTISPWSSKATDIIKNTGIKAVKRIERAILFGVEGQVSASELKQIQDIVHDRMVEEVFS
00495271   1/1  ----------------------------------------------------------------------
00438671   1/1  ----------------------------------------------------------------------
00495282   2/3  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00438651   1/1  dgllllvgPRlgtisPwsskatdIahncgLdkveRiErgiryllelkslsdeeleallallhDrmtelvy
00495292   2/2  ----------------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           CKDDLYRLFSVTAPKELEFVNVLEKGAQAIKEADRKLGLALSEQEIEYLADEYTKLGRNPTDTELYMFAQ
00495271   1/1  ----------------------------------------------------------------------
00438671   1/1  ----------------------------------------------------------------------
00495282   2/3  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00438651   1/1  ldlldaaalfd-----------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00502161   1/2  --------------------------------------------eldylllllegldlkpalvellalpn
00479491   1/1  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00495261   1/1  -----------llpevlllvdllelgeeeleelnlelglaLsldelellvelfkelgrnPtdvEllvlaq
00484821   1/1  ----------------------------------------------------------------------
00502171   1/2  ------------------------------------------------------------tdtelevlll
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  ------------------------------------ifnadlvidgedleeallkllrlpnvaskeflit


                         -         -         -         +         -         -         -:280
query           ANSEHCRHKIFNAKWTIDGQEQDKSLFKMIRNTTEKSPQGVLSAYKDNAAVIEGATAQRFYPNTQTGVYS
00495271   1/1  ----------------------------------------------------------------------
00438671   1/1  ----------------------------------------------------------------------
00495282   2/3  ---------ifnadlvidgedleeallkllrlpnvaskeflitqyddhvggltvlkplvglppgadaavv
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00502161   1/2  vaskhclikifdrtv......................gggvllgpgddaavvr.................
00479491   1/1  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00495261   1/1  awSeHCrhk-------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00502171   1/2  tllehcniaskelileqydhtvggntvlgpg...............ddAaviri................
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  qyddhvggl-------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           FNQEEVDILMKVETHNHPTAIAPFSGSATGVGGEIRDEGATGLGAKPKAGLTGFTVSNLNIPGFEQAWET
00495271   1/1  ----------------------------------------------------------------------
00438671   1/1  ----------------------------------------------------------------------
00495282   2/3  rlgedtglamkvethnhpsaidPyaGAatavgeairdivavGrGakpiAgldglnfgnleipglsapwea
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00502161   1/2  lg.ddtglvmstdghntpllidpyagaatavaeavrDiaamG..Arplalldslafgnl...........
00479491   1/1  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00502171   1/2  ..gdglalalktdthnrpsaidpyggaatavaeavrdilamG..Arplalldvlnfgdpd..........
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SKYGKPNHIVTPLQIMLEAPIGGAHYSNEFGRPNLNGYFRTYEQEVNTSAGKEMFGYHKPIMIAGGMANI
00495271   1/1  ----------------------------------------------------------------------
00438671   1/1  ----------------------------------------------------------------------
00495282   2/3  a.agkpgeiaspldilveavlGiadygnalgiPvigGkdslsnetvgkdgggevrvyipptlvigavGlv
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00502161   1/2  ...............laeavkGiadacnalgvplvgGktslspetv...........ipptlvvgavGvv
00479491   1/1  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00502171   1/2  ..........lpekllqlvveGiadacnalgvpvvgGnvslyneyvg...........kpilptlvigav
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           KRMHVEKGDIKVGAKLICLGGPAMRIGLGGGAASSVVSSDTNSELDFASVQRDNAEMERRCQEVIDRCWQ
00495271   1/1  ----------------------------------------------------------------------
00438671   1/1  ----------------------------------------------------------------------
00495282   2/3  ddvriivtp-------------------------------------------------------------
00495291   1/2  ---------lkpGdlllllglttgriglggsalasvllglgsgeldlpdvqvgdpellkklqeliealle
00438691   1/2  ------pdfkkpGdvllllglstgrdglggsalasvllg.....lgfgavqvgdpelekklfea...vle
00448221   1/2  -------dfakpGdvlillglltgrdglgGsallsvllglg..dldfgavpvgdlellkrlvea...lle
00495283   3/3  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00502161   1/2  eddrvirg--------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00502171   1/2  gkldvvrg--------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  -----dgsnikaGDvliglass....Glhsngyslvrkilelsglllsdllplgktlgellltptriyvk
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           MGENNPITFIHDVGAGGISNAFPELVKDGGGGGYFELRKVNVGEEGLSPLEIWSNESQERYVLSVDPESL
00495271   1/1  ----------------------------------------------------------------------
00438671   1/1  ----------------------------------------------------------------------
00495282   2/3  ----------------------------------------------------------------------
00495291   1/2  lieeglilaahDvsdGGlavalaEmafagglGaeidldavplreegldpleilfsEsqgrlvlavkpedl
00438691   1/2  lieeglilaahDvsdGGLavalaEmafagglGaeidldavp.....lsplellfse.qermvlaVkpeda
00448221   1/2  lieeglvlaahDvsdGGlavalaemafasglGaeidldkvplrpegldllellfsesqgrlvlavppeda
00495283   3/3  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00502921   1/2  ------vhamtDvt.GGLlgdllelaeasgvgavldldklpllpevlelaellgldpldlalsgGedyel
00360511   1/2  lvlellkagdvhalahiTGgGllenlprvlp.sglgavidldswpvppifkllqeagnvlglemlrtfnm
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           ELFEQLCNRERCPFAVVGEAISEKHITLNDEYFDNKPVDLPMGLLFGNTPQMHIDVKTVKVEQQAFDTSA
00495271   1/1  ----------------------------------------------------------------------
00438671   1/1  --------------------------------------------------------etlkaalealdlsl
00495282   2/3  ----------------------------------------------------------------------
00495291   1/2  eavlailekeglpaaviGevtedgrlvlktalggervvdlpleellgawpetlrel--------------
00438691   1/2  eavlaileraglpelaaviGevtedgrlvit..vggevvvdlpldeLleawpetlrellrlrdnpalale
00448221   1/2  eavleilekaglpaaviGevtedgrlvvv..lggevvvdlpldellgawpetl-----------------
00495283   3/3  ------------------------------------------------------------ifnadlvidg
00438692   2/2  ----------------------------------------------------------------------
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00502162   2/2  -----------------------------------------------------------eldyllllleg
00501381   1/1  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00502921   1/2  lftvppeladal........vdaaviGevtegegv-----------------------------------
00360511   1/2  GiGlvlvvpeedadavlallkklgeeawiiGe--------------------------------------
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  --------------------------------------------------------------------td
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           IKLDEAIERVLKVPAVASKSFLITIGDRSITGMVARDQMVGPWQVPVADCAVTTATVDSQAGEAMAMGER
00495271   1/1  ----------------------------------------------------------------------
00438671   1/1  ldlneallrvLshpnvaskeflvrqyDrsvggltvlkpgvGplqlpvaDaavvrlslgtlkglamsiGen
00495282   2/3  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  eyelllgealprllalptvaskefli--------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  edleeallkllrlpnvaskeflitqyddhvggltvlkplvglp..pgadaavvr..lgedtglamkveth
00438692   2/2  ----------------------------------------------------------------------
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00502162   2/2  ldlkpalvellalpnvaskhclikifdrtvgg........gvllgpgddaavvrl..gddtglvmstdgh
00501381   1/1  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  televllltllehcniaskelileqydhtvggntvlgpg........ddAaviri..gdglalalktdth
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           TPVAAINAAASGRLAIAETVTNLLAADIEKLSDIRLSANWMVAANQGDENQKLYETVRAVGMEFAPALGI
00495271   1/1  ----------------------------------------------------------------------
00438671   1/1  pryalldpyagaalAvaEalrnlvaagagpladvtlslnfgwpegnpeelaqlyeavlalgkdacralgv
00495282   2/3  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  nhpsaidPyaGAatavgeairdivavGrGakpiAgldglnfgnleipglsapweaaagkpgeiaspldil
00438692   2/2  ----------------------------------------------------------------------
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00502162   2/2  ntpllidpyagaatavaeavrDiaamGArplalldslafgnl............laeavkGia.dacnal
00501381   1/1  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  nrpsaidpyggaatavaeavrdila---------------------------------------------
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           AIPVGKDSMSMKTKWSDNGQAKSVTSPLSLVISGFSPVTNARKTLTPVLVDDNDTTLLHIDLSNGAGRLG
00495271   1/1  ----------------------------------------------------------------------
00438671   1/1  pvvsGkvSlynetklkdggegkevaipptlvisavglvedvrktvt------------------------
00495282   2/3  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  veavlGia.dygnalgiPvigGkdslsnetvgkdgggevrvyipptl-----------------------
00438692   2/2  -----------------------------------------------pdfkkpGdvllllglstgrdglg
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  -------------------------------------------------lkpGdl.llllglttgriglg
00502161   1/2  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00448222   2/2  ------------------------------------------------dfakpGdvlillglltgrdglg
00502162   2/2  gvplvgGktslspetvi...........pptlvvgavGvveddrvi------------------------
00501381   1/1  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------Gdgalg
00495281   1/3  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           ASCLAQAYNQVGNVAPDIEASKVKVLFENITKLKAENKILAYHDVSDGGVFATLAEMSFAGRKGLDVKLQ
00495271   1/1  ----------------------------------------------------------------------
00438671   1/1  ----------------------------------------------------------------------
00495282   2/3  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  ----------------------------------------------------------------------
00438692   2/2  gsalasvllglgfgavqvgdpelekklfeavlelieeglilaahDvsdGGLavalaEmafagglGaeidl
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  gsalasvllglgsgeldlpdvqvgdpellkklqelieallelieeglilaahDvsdGGlavalaEmafag
00502161   1/2  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00448222   2/2  GsallsvllglgdldfgavpvgdlellkrlveallelieeglvlaahDvsdGGlavalaemafasglGae
00502162   2/2  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  -----------------------riyvklvlellkagdvhalahiTGgGllenlprvlp.sglgavidld
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  lallrggleldeellslllellllpnprlaallallglvhamtDvt.GGLlgdllelaeasgvgavldld
00495281   1/3  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           TQDVLAKLFAEEVGVVIQVRNSDVSLVEEMFKDTQIHLCAIAKLNSSDELNIFANGEKTYSNTRVNLQRW
00495271   1/1  ----------------------------------------------------------------------
00438671   1/1  ----------------------------------------------------------------------
00495282   2/3  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  ----------------------------------------------------------------------
00438692   2/2  davplsplellfseqermvlaVkpedaeavlaileraglpelaaviGevtedgrlvitvggevvvdlpld
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  glGaeidldavplreegldpleilfsEsqgrlvlavkpedleavlailekeglpaaviGevtedgrlvlk
00502161   1/2  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00448222   2/2  idldkvplrpegldllellfsesqgrlvlavppedaeavleilekaglpaaviGevtedgrlvvvlggev
00502162   2/2  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  swpvppifkllqeagnvlglemlrtfnmGiGlvlvvpeedadavlallkklgee----------------
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  klpllpevlelaellgldpldlalsgGedyellftvppeladal........vdaaviG-----------
00495281   1/3  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           WAETSYQIQSIRDNSECAKQEFDSILNTNDKGIHVEATFDLEEDITAKFVNVEKPKVTILREQGVNGQVE
00495271   1/1  ------------------------------------------------ilplakpkvavlvfpgsncdrd
00438671   1/1  ----------------------------------------------------------------------
00495282   2/3  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  ----------------------------------------------------------------------
00438692   2/2  eLleawpetlrellrlrdnpalaleeyelllgealprllalptvaskef---------------------
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  talggerv--------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------agkpvigvlpglvprilv
00448222   2/2  vvdlp-----------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00501381   1/1  ---------------------------------------------------mgkpvigilgkyilllday
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  ---------------------------------------------------mmkmkilvldlpgsgnlqs
00502171   1/2  ----------------------------------------------------------------------
00506451   1/1  ------------------------------------------------------mkilvldfggsnle.s
00477711   1/1  -------------------------------------------------------kiivivdpgsgnlrd
00397821   1/1  -------------------------------------------------------gallkvivivdygsg
00473241   1/1  ------------------------------------------------------mkilvldfygsnte.s
00457521   1/1  ------------------------------------------------------leglgllelvlvllll
00472861   1/1  ------------------------------------------------------mkvlll.dygdsftes
00379031   1/1  ------------------------------------------------------kkilvllfdgfellel
00492981   1/1  ---------------------------------------------------kkevkiavvgdygsltgnl
00399881   1/1  ------------------------------------------------------mkilvidlggsnle.s
00426481   1/1  ------------------------------------------------lkaldgvkiavldfggnytsll
00418671   1/1  -------------------------------------------------------alllskrlsllllll
00517421   1/1  ----------------------------------------------------------aevligvlildg
00431811   1/1  -----------------------------------------------------kmkiavldfggnytsll
00427221   1/1  -----------------------------------------------------mkkilii.dfgdsflyn
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           MAAAFTTAGFEAHDVHMSDLHAGRVTLADFKVLVACGGFSYGDVLGAGGGWAKNILFTEKLRDEFSRFFG
00495271   1/1  laraferaGfeavlvhmsdllagrvllddfdglvlpGGfsygdvlgggaiaaasllmndklelallkffa
00438671   1/1  ----------------------------------------------------------------------
00495282   2/3  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00479491   1/1  ldygsgnlyrsiaralreaGaevvvvpvdltleeipellddadglilpGGpsdvddlgalrrd.......
00448222   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00501381   1/1  dsvtaalylagrllgvgvevvvvgadvltleeipellddadglvlpGGpgspddlg..............
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  iaralreagvevvvvpaddltldeilledadglilpGGpgdpldlgalprieg.......lielireale
00502171   1/2  ----------------------------------------------------------------------
00506451   1/1  laralrelgaevevvpvd.ldleeillldadglilpGGpsvgda...............glleaireale
00477711   1/1  iaralrelgvevevvrdpe......dledadgiilpGgfstrgdlr........llrlsglieaireal.
00397821   1/1  nlrdlaralrelgvevevvpid....edillldadglilPGggstvddlr........llrleglieair
00473241   1/1  lvralrelgaevevvpvdleletlpeelllldpdglilpGGpgspdllg...............lleair
00457521   1/1  dlleldlvawvsllelllnpggevriavid.ygsf..ynilralrelgaevevvpvd.idaeelealdpd
00472861   1/1  laralrelgaevevvpvdlelletldeidlldpdglilpGGpgsvgde...............glieair
00379031   1/1  asplralreagaevevvspdggpvtssnglalladltldevdledyDalilpGGpgtvdllrd.......
00492981   1/1  lsilealehagaevvvkveilwvpsdlleeeilellkgadgillpGGpgdpg...............veg
00399881   1/1  lvdalrelgaevevvrvdvlde..edledadalilPGggspadalrll.........rleglieaireaa
00426481   1/1  ..ralrelgaevvvvssled......legadglilpGGfstvdllllr..........nsglleaireaa
00418671   1/1  llkllaskkilvllfdgfedlelvgpldalrragaevvvvspdgglpvvgshgllvvtadttlddvdled
00517421   1/1  gvgnhisvlaalerlgvevvvvrkped......lkdidglilPGggsttialla.......llariglll
00431811   1/1  ..ralreagaevvvvspded......ledadglilpGGpgtvyal.....llrdeglleaireaa.....
00427221   1/1  lvralrelgvevvvvpvdaltleeilllnpdglilpGGpgspydarde...........gllelireale
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           RDDTLALGVCNGCQMLAQLKSLIKGAENWPIFIKNKSEQFEARVSMVEIQESDSIWFADMACTKAPIAVA
00495271   1/1  rrgkpvLGiCnGfQlLvelgllpggdlldpaltrnasgrfesrwvtlrvenspsiflsglagsvlpvpva
00438671   1/1  ----------------------------------------------------------------------
00495282   2/3  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00479491   1/1  egllelirealergdlkPvlGIClGmQlLaealggkvikgpggeegvvvpvellglllvstlflg.lpsp
00448222   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00501381   1/1  lleairealer.gkpvlGIClGmQllaealggkveklpgaelglldpevtrnvvglleesfvlve.....
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  a.gkpvlGIClGhQlLae.........alggkverlpegpelgllpvevt.egsplfrglgde.lrvyei
00502171   1/2  ----------------------------------------------------------------------
00506451   1/1  algkpvlGiClGmqllaea....lggkvvr......lkvpehgwvsviltd.gsplfkglg.deltvyfs
00477711   1/1  ergiPvLGIClGmQlLaealggpvgleglgllgggvlllgtlrlphmgwnll...........elplllg
00397821   1/1  ealeag.kPvLGIClGmQlLaealggpgsvpglgllpgkvvrnkegrlvvphlgwnvvvl...dsplfkg
00473241   1/1  ealeagvpvLGiClGhQllaea....lggkvlr......lktgelgwnsvvlte.gsplfkglg.dvliv
00457521   1/1  glilpGG.............pgdprrleglieairealeag.kPvlGIClGhQllaea............
00472861   1/1  ealeag.vpvLGiClGhQllaealggkvlrlktgrlgwnsvvlteg...........splfkglg.dvli
00379031   1/1  ....pgllelireaae.agkpvlgi---------------------------------------------
00492981   1/1  lieairealengiPvLGIClGmQllavalggnvlglkdahsgefseetnhpvlgllpglvlrnallelvd
00399881   1/1  esgkpvlGIClGmqlLaealggkvgvpglglld...........................gktvrlykgr
00426481   1/1  eagkPvlGiClGlqlLaealggpgvpglgllpgkver......lalgrtvlslvgdlllpglgwn....l
00418671   1/1  yDalvlPGGfga.ddlrad......---------------------------------------------
00517421   1/1  alikfviakgkpvlGiClGmQlLaeasgepgvleglgeigglgllditvvrnafgrqphsgwndlkikgl
00431811   1/1  eagkpvlGiClGmqlLaealggkvvkglgllpg...........................kvvteyrglt
00427221   1/1  ag.kPilGIClGhQllala....lggkvlkl..........................kvgelgwnsvvlt
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           HGEGRPLFENDNQQQAMLASAQVALKYIDGQGQATEMYPYNPNGAVNGLTAVTALDGRVLAMMPHPERVY
00495271   1/1  HgegvfeladdlvlaaleedgqvalrYvdndgnpteeyPlNPnGslngiagitsedgrvlglmpHPErav
00438671   1/1  ----------------------------------------------------------------------
00495282   2/3  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00479491   1/1  llkgs..llapia..ygvhsyevneihgdaveelpeglvvlat.............spdgsveaiegidh
00448222   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00501381   1/1  ..llgvphlgwnpvalaegsllfkglge.eliverhrhryevhsdavdrllpeglevlatsp.dgngsll
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  Hsd.vtelpeglevlat.......................sedgs...ieairhkd..vlgvqfHPEf--
00502171   1/2  ----------------------------------------------------------------------
00506451   1/1  Hsyav.......................delpeglevlatsedgs...ieaielkdgpvlgvqfHPEfts
00477711   1/1  igegvygyevhsyrtlp.nglavlaltedg.................viagaavrdgnvlGvqfHPEfss
00397821   1/1  lgee.lrvyeiHsyavevnd..etlellpegllvlattedgg................viagaavekg--
00473241   1/1  yfsHgyavde..........lpeglevlatsdg.................tieaielkdgpvfgvqfHPE
00457521   1/1  ..........................lggkvvrlkvg.hsgensplfkglggdviivyhsHgyavnlesl
00472861   1/1  vyfsHsyavte..........lpeglevlatsdg.................tieaielkdgpvlgvqfHP
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  slsdlggtmrlGwhpvvlv..egsllfkgygkgl..iivrhrHsyavdplylplleeeglvvtatspdgg
00399881   1/1  lphvgvngplfkglpdpltvyeiHslrvevlpdgllvlars....dgl...iegiehkdgnvlGvqfHPe
00426481   1/1  rgyeihadlveglpegaevlavhdg..........................agaavrkgnvlgvqfHpel
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  splfkgilnksify.fvhsyiraplied..........................vgvtvavlsyggef--
00431811   1/1  lpvvgadalfvglevvvhgyevhsdaveelpeglevlats...ddg....ieaie..hgnvlgvqfHp--
00427221   1/1  lvtdgsllfkglgdelivyfyHsyavdelpeglevlatslddgl......veaiehkdlpvfgvQfHPEs
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:1330
query           RAITNSHIPAEYDEYSVWMRMFRNARKWVG----------------------------------------
00495271   1/1  epvqwsilpdkllgvspglrlFrnavkwlk----------------------------------------
00438671   1/1  ----------------------------------------------------------------------
00495282   2/3  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00495283   3/3  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00438651   1/1  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00479491   1/1  k---------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00501381   1/1  glieaiehkdgpvflGvqfHPErsltpl.-----------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00506451   1/1  g..............plglrllrnfleaage---------------------------------------
00477711   1/1  dp--------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00473241   1/1  l............sltplg..lrlfrnfleaa--------------------------------------
00457521   1/1  peglevla--------------------------------------------------------------
00472861   1/1  Els..............ltplglrlfrnflea--------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00492981   1/1  l..veaielkdhpfv-------------------------------------------------------
00399881   1/1  fsse...............aglrllknfl-----------------------------------------
00426481   1/1  s---------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00427221   1/1  s............lgplg..lallknfle-----------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00360511   1/2  ----------------------------------------------------------------------
00360512   2/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------
00495281   1/3  ----------------------------------------------------------------------