[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for halo0:AAG19034.1


[Show Plain Result]

## Summary of Sequence Search
   1::373
  26::363  PF00155 0.0% 25.748502994012  Aminotransferase class I and II 
  89::196  PF01041 0.0% 38.2352941176471  DegT/DnrJ/EryC1/StrS aminotransferase family 
  45::194  PF01212 0.0% 25  Beta-eliminating lyase 
  87::200  PF01053 0.0% 26.3636363636364  Cys/Met metabolism PLP-dependent enzyme 
  87::197  PF00266 0.0% 25.9259259259259  Aminotransferase class-V 
   1::373


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTEFSDRVAQVSISGIRAVFEAAGEDAINLGLGQPDFPTPDHARQAAVDAIESGAADGYTSNRGTAALVD
PF00155         -------------------------dvinLgsneylgdsgkptlpevakaekegalaggtlneygpidgl
PF01041         ----------------------------------------------------------------------
PF01212         --------------------------------------------daq.aaanlGde.aYgedktvarled
PF01053         ----------------------------------------------------------------------
PF00266         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AIVEKHARDQGVDVAPAGVIATAGGSEALHLAMEAHVDPGDEVLFPDPGFVSYDALTRMAGGNPVGLPLR
PF00155         peleealakflgrseklklkreaavvvgsGagaliealifllklnpgdeilvpdptyasyknilrlsgge
PF01041         ------------------avavssGtaAlllaLralgigpGdeVIvpsltfvAtanavlqlGakpvfvDv
PF01212         avaellgkeaalf........vpsGtaAnqialsallqreeevvvtepshihfdetgaikelggvklvtl
PF01053         ----------------eaalavsSGmaAiaaallallkaGdevvatddlYggtqrllekvlkk.lgvevk
PF00266         ----------------eeiiFtsgttealnlvalslarslkagdeilvteaehhanlvpwqelakrtgak


                         +         -         -         -         -         *         -:210
query           DDLTLAPETVEDHITDDTAAFVVNSPANPTGAVQSPADMRAFARIADEHDVLCISDEVYEHIVFEGEHRS
PF00155         vvryplyseedfhldlealeealkeapegnkktkvvlvesphNPtGtvatleeleklldlakkynlllfv
PF01041         dpetlnldpaaieaaitprtkaIl...pVhlyGq...padmdairaiaaehglkvi--------------
PF01212         knkeagkldleklealikevgaheenialisltitnntaGGqvvsleelreiae----------------
PF01053         fvdtsdleelekaikpntklvylEtptnpllkv...vDieaiaklakkkgdvlvvvDntf----------
PF00266         vkvipvdeegsldldeleklltpktklvaithvsnvtGvvq...pveeiaklakeag-------------


                         -         -         -         +         -         -         -:280
query           PMEFADTDNVVVVNACSKTYSMTGWRLGWVAASERRAERMLRVHQYVQACASAPAQYAAEAALSGPQGVV
PF00155         DeaYagfvfgsldavatranveeepnllivgslsKafGlaGeRvGyilgnaavvsqlrklsrpfls..ss
PF01041         ----------------------------------------------------------------------
PF01212         ----------------------------------------------------------------------
PF01053         ----------------------------------------------------------------------
PF00266         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DEMVAAFEARRDVLLDGLEAMGLDVPTPGGAFYAMPTVPDGWIDEVVDRGVVVVPGSAFGDHGAGTARIS
PF00155         llqaavaaalsdallkqseleemrqrlqkrrkelrdeLaelglkvlasqsgmflltdlsaetakelskkL
PF01041         ----------------------------------------------------------------------
PF01212         ----------------------------------------------------------------------
PF01053         ----------------------------------------------------------------------
PF00266         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           YATDMATLRDAIDVMRAATAAVQ-----------------------------------------------
PF00155         leevgvyvtpgts---------------------------------------------------------
PF01041         ----------------------------------------------------------------------
PF01212         ----------------------------------------------------------------------
PF01053         ----------------------------------------------------------------------
PF00266         ----------------------------------------------------------------------