[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for halo0:AAG19981.1


[Show Plain Result]

## Summary of Sequence Search
   1::462
 185::455  PF03441 0.0% 43.7262357414449  FAD binding domain of DNA photolyase 
   3::158  PF00875 0.0% 37.012987012987  DNA photolyase 
   1::462


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHLYWHQRDLRVPDNRGLHAATDGDTVVPVYVFDDTVLSQVGRPKRAFLAAGVRALRAAYRERGSDLLVR
PF03441         ----------------------------------------------------------------------
PF00875         --lvWfrrDLRlhDnpALaaAaasgepvvpvfildpe..eehklkvgaarrkfllesLedLkesLaklgs


                         -         -         *         -         -         -         -:140
query           EGDAESVLPALADEFDADTVFHAAHYDAARRNRRTRVADALAAAGVDTAGHVDHTLVDPATLDDAYPSHS
PF03441         ----------------------------------------------------------------------
PF00875         rLlvrrgdpaevlpelakelgvsavyanreyepdererdeavkealrkagievhsfddhllvepgevktk


                         +         -         -         -         -         *         -:210
query           QFYDDWQQAPKPDPVPAPDADALADVHDDHTLSVPAPEPPLPDAGHAAATDRLAAFLDDGIASYNDTRDD
PF03441         --------------------------------------------GeeaalkrleeflkerlknYekerdd
PF00875         kgkpykvFtpfrkkwlkk----------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LAAAVDAPASAVSRLSPYLAAGNIGVREVWAAVADAYDDATGNAARNIGKYRYELSWREQNYHLLYHTPR
PF03441         paed......stsrLSpylkfGeiSprevyqelkaakk.eekkksksaeaflseLvwRefyyqllahnpe
PF00875         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LQTENYVSFDAPIAWQNSDDHFEAWTRGETGYPLVDAGMRQLRAEGYVHNRPRQVVASFLTKHLLVDWRR
PF03441         lakkeelnekydal.pweedkkdeeeleawkeGrTgfplvDAamrqLretGwmhnrlRmvvasFltkdLl
PF00875         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GERHFADRLVDYDPANNAANWQWTASTGTDTVAVRIFDPVSQMAKYDSDAAFVTEYVPELRGVDPETIVD
PF03441         idWregeewfaetlvDaDlainaggwqwlsgtgadaqpyfrifnpvkqskkfDpdgeyirrwvPelknlp
PF00875         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           WPTLRHSQRERLAPDYHHPIVDRDHAYERAQRVFEAALDGDA----------------------------
PF03441         dkyihepwkaekevqkkagcvlgedYpkpivdhke-----------------------------------
PF00875         ----------------------------------------------------------------------