[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for halo0:AAG19982.1


[Show Plain Result]

## Summary of Sequence Search
   1::536
  28::63   PF01266 0.0% 48.5714285714286  FAD dependent oxidoreductase 
 227::503  PF01266 0.0% 26.5700483091787  FAD dependent oxidoreductase 
  37::309  PF01593 0.0% 17.6245210727969  Flavin containing amine oxidoreductase 
  28::69   PF01494 0.0% 47.6190476190476  FAD binding domain 
  28::59   PF07992 0.0% 53.125  Pyridine nucleotide-disulphide oxidoreductase 
  26::65   PF01946 0.0% 47.5  Thi4 family 
  28::62   PF03486 0.0% 48.5714285714286  HI0933-like protein 
 232::291  PF03486 0.0% 20  HI0933-like protein 
  28::63   PF00890 0.0% 47.2222222222222  FAD binding domain 
  28::61   PF01134 0.0% 50  Glucose inhibited division protein A 
  29::62   PF00070 0.0% 50  Pyridine nucleotide-disulphide oxidoreductase 
   1::536


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPHQSQPGFLLPAIQHHSMQGSLPGERDVTVVGGGFGGLAAAAYLARAGASVTLLEQHDTVGGRAGVLER
PF01266         ---------------------------dvviiGgGivGlstAyeLarrglkVtllekg.dias-------
PF01266         ---------------------------dvviiGgGivGlstAyeLarrglkVtllekg.dias-------
PF01593         ------------------------------------aGLaAArqLlqaGfdVtvlEArdrvGGRirtfrs
PF01494         ---------------------------dVlIVGaGpaGlmlallLseaGvrvvlvekhsttvvlprAdg-
PF07992         ---------------------------dvviIGgGpaGlaaakrlarlglkvalierep-----------
PF01946         -------------------------esDvvivGaGssGltaayylakkdlkvailerklsiGGGa-----
PF03486         ---------------------------dviviGgGaAGlmaAisaakrgakVllldkakklg--------
PF03486         ---------------------------dviviGgGaAGlmaAisaakrgakVllldkakklg--------
PF00890         ---------------------------DvvViGsGlAGlaAAleaaeaglkvavvekeqetgg-------
PF01134         ---------------------------dviViGgGhAGceAAlaaarlGakvlLithkldt---------
PF00070         ----------------------------vvvvGgGyiGlElAaalaklgkkVtvierrdrll--------


                         -         -         *         -         -         -         -:140
query           DGFRFDTGPSWYLMPDVFERFFDHFDHDPHDFYELTRLDPQYRVFWTDGDSATIEPNRRNAHELFESYEE
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01593         kgdgylielGamwftgvygnllnlllelglelnlelfpftqkvflrlkygggvpkekdddlepeegll..
PF01494         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GAGDALATYLDRAATNYDLAMNRVVYPDRTAFRDYASTDMLPLASRLRLFGNMDDYVSRFFDHPKLRQLL
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01593         ....sllssllefrrllespeslsqalesglllaepellelalesfssllsaqgflersle......slf
PF01494         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EYTLVFLGGAPHNTPALYSIMSHVDLNGNVFYPEGGIAGVVDALAELAVEQGATIETGVGVNAISGRRGE
PF01266         ----------------replls.pdlkgglfypddgqvdpaklvkalaraaeelGveiiegtkVtglere
PF01266         ----------------replls.pdlkgglfypddgqvdpaklvkalaraaeelGveiiegtkVtglere
PF01593         ralldgalgflefensarlallslklndqeddgvefpgggltvpngylsvlvalaegldggvvrlnkrVk
PF01494         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF03486         ---------------------lkeedsgrlFpvsdkakdivdallkelkeagvkirletevksvekeedg
PF03486         ---------------------lkeedsgrlFpvsdkakdivdallkelkeagvkirletevksvekeedg
PF00890         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           FTLATDDGTRTTDLVVNNANPAYAERELLDTGGRDHAPDYWDDQTYAPSALMFYLGVEGDVEPLAHHSLV
PF01266         ggrvsgvrtedgsiradkvvlAaGawssk..llkllgldl.......................pirpvrg
PF01266         ggrvsgvrtedgsiradkvvlAaGawssk..llkllgldl.......................pirpvrg
PF01593         sitkegdgvtvttedgetykaDaVvvTlp-----------------------------------------
PF01494         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF03486         afrvktkseee-----------------------------------------------------------
PF03486         afrvktkseee-----------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LPPDWDGHFAQLFDDPGWPDDPAFYLSVASKTDDTVAPDGHEAVVILLPIAPGLDDTPEIRAQYRDRLLG
PF01266         qvlvtepltdelaaavilgpvavldargvfv...........lpre.gevlvgttd.grldrgataeess
PF01266         qvlvtepltdelaaavilgpvavldargvfv...........lpre.gevlvgttd.grldrgataeess
PF01593         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           TLAAQTGVDLRDRIVVEESACVSEFSEQFGDPGGTALGLAHTLFQTGPLRPGKRDGPDGHYYVGAYTNPG
PF01266         gedvdvdlevdelleaak.kllpqlkdaeilrawaGlrpvt.............................
PF01266         gedvdvdlevdelleaak.kllpqlkdaeilrawaGlrpvt.............................
PF01593         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           IGMPMCLISGEHVTKAVIDDDPAASGSTDPLAVPGEFNFDTPTTAD------------------------
PF01266         .pdglpvigevpe---------------------------------------------------------
PF01266         .pdglpvigevpe---------------------------------------------------------
PF01593         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------