[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for halo0:AAG19981.1


[Show Plain Result]

## Summary of Sequence Search
   1::462
 175::454  2.8e-93 44.5% 0041500 00415001 1/1   ochrome/photolyase FAD-binding domain   
 183::459  1.2e-91 43.8% 0036512 00365121 1/1   ochrome/photolyase FAD-binding domain   
 167::463  2.8e-89 41.6% 0044199 00441991 1/1   ochrome/photolyase FAD-binding domain   
 181::461  6.7e-85 44.8% 0048653 00486531 1/1   ochrome/photolyase FAD-binding domain   
 179::456  4.5e-79 48.0% 0039138 00391381 1/1   ochrome/photolyase FAD-binding domain   
   1::200  5.6e-36 31.6% 0048654 00486541 1/1   ochrome/photolyase, N-terminal domain   
   1::189  2.8e-34 28.9% 0046364 00463641 1/1   ochrome/photolyase, N-terminal domain   
   1::186  5.3e-34 30.6% 0048411 00484111 1/1   ochrome/photolyase, N-terminal domain   
   1::190  5.7e-33 35.8% 0047421 00474211 1/1   ochrome/photolyase, N-terminal domain   
   1::160  8.1e-33 31.2% 0049782 00497821 1/1   ochrome/photolyase, N-terminal domain   
   1::462


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHLYWHQRDLRVPDNRGLHAATDGDTVVPVYVFDDTVLSQVGRPKRAFLAAGVRALRAAYRERGSDLLVR
00415001   1/1  ----------------------------------------------------------------------
00365121   1/1  ----------------------------------------------------------------------
00441991   1/1  ----------------------------------------------------------------------
00486531   1/1  ----------------------------------------------------------------------
00391381   1/1  ----------------------------------------------------------------------
00486541   1/1  kivlvWfrrDLRlhDnpaLlaAlesglpvlpvfildpellgahdlgprrlrFllesLedLdksLrklgip
00463641   1/1  spvlvWfrrDlRlhDNpaLlaAleladapvlplyifdplllgfldagprrlrFllesLedLdesLaklgi
00484111   1/1  lalkkkivlvWfRrDLRlhDNpaLlaAlesgdpvlpvyildpellgqtslglhdlgparvwFllesLedL
00474211   1/1  gvvlvWfrrDlRlhDnpaLlaAlesgpvlpvfildpell.dlgprrlrFllesLadLdesLralgspLlv
00497821   1/1  lvlvWfrrDLRlhDNpALlaAlesgpvlpvyildpellglhdlgaarlwfllesLedLdksLrklgipll


                         -         -         *         -         -         -         -:140
query           EGDAESVLPALADEFDADTVFHAAHYDAARRNRRTRVADALAAAGVDTAGHVDHTLVDPATLDDAYPSHS
00415001   1/1  ----------------------------------------------------------------------
00365121   1/1  ----------------------------------------------------------------------
00441991   1/1  ----------------------------------------------------------------------
00486531   1/1  ----------------------------------------------------------------------
00391381   1/1  ----------------------------------------------------------------------
00486541   1/1  Llvlrgdpvevlpelakelgatavfanreyepyererdkavkealkelgievhefddhllvepgevltkl
00463641   1/1  pLlvlrgddfkepvevlpelakelgatavvanreyepyererdeavakal..ngievhevddhllvppge
00484111   1/1  desLrklgirLlvrrgdplevlpelikelgitavywnreyepyererdkavkkalkelgievhsfndhlL
00474211   1/1  lrgdpvevlpelakelgatavfanreyepyererdaavkealk........fddhllvepgevltgvgrp
00497821   1/1  lvrrgdpvevlpelakelgisavywnreyepyelerdkavkkllkelgievksfkgnlLfepgevltkdg


                         +         -         -         -         -         *         -:210
query           QFYDDWQQAPKPDPVPAPDADALADVHDDHTLSVPAPEPPLPDAGHAAATDRLAAFLDDGIASYNDTRDD
00415001   1/1  ----------------------------------gdlevflwpgGesaAlkrLddfleerllladYgetr
00365121   1/1  ------------------------------------------pgGesaAlerLedfleerladYgetrda
00441991   1/1  --------------------------edlleldlgvllvllwpggesaAlerLdefleerladYgesrnf
00486531   1/1  ----------------------------------------lfpgGeeaAlerLddfleerladYgktrna
00391381   1/1  --------------------------------------lflwpggeaaAlerLdafledrladYgetrda
00486541   1/1  gkpykvFtpfrkkwlkllppaplpaplllpllplla.......llllllllllgldlleg----------
00463641   1/1  vltklgkpykvftpfrkavlkellvppplplplpaalplvlldlpdlal---------------------
00484111   1/1  fepdevltklgdpykvftpfrkkvlklllppppplppallpllpll------------------------
00474211   1/1  ykvftpfrkawlklllpppplllp................lplptledlg--------------------
00497821   1/1  tpykvftpfwkkwlklllep--------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LAAAVDAPASAVSRLSPYLAAGNIGVREVWAAVADAYDDATGNAARNIGKYRYELSWREQNYHLLYHTPR
00415001   1/1  daplgld......atSlLSPyLafGllsprevllavlkayse..dlalnsveaflreLlWReffylllyy
00365121   1/1  pagd......atSrLSpyLafGllsprevllavlkaykg..daplasveaflreLlWReffrllllhfpd
00441991   1/1  pald......atSlLSPyLhfGllsprevylavlkalkelkleglklalesveaflreLlWReffrnlly
00486531   1/1  plld......atSrLSpyLafGllsprevylavlkayaellgdaplesveaflreLlwReffrqlleyfp
00391381   1/1  plld......atslLSpyLafGllsprevllavlkayse.......sveaflreLlWReffrnlllyfpd
00486541   1/1  ----------------------------------------------------------------------
00463641   1/1  ----------------------------------------------------------------------
00484111   1/1  ----------------------------------------------------------------------
00474211   1/1  ----------------------------------------------------------------------
00497821   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LQTENYVSFDAPIAWQNSDDHFEAWTRGETGYPLVDAGMRQLRAEGYVHNRPRQVVASFLTKHLLVDWRR
00415001   1/1  fpdllslnllpewdaidwredeelleaweeGrTgyplvdaamrqLlatGwmhnrlRmivAsfltkdllld
00365121   1/1  ylallnllewarklpwrndlelleaweeGrTgyplvdaamrqllatGymhnrlRmivasfltklllldWr
00441991   1/1  yfpdllslnllpeyaqipwendredleaweeGrTgyplvdaamrqLvatGwmhnrlRmivAsfltkdlll
00486531   1/1  dllfrnllpawaripwdadeelleaweeGrTgyplvdaamrqLlatGymhnrlRmivasfltklllldWr
00391381   1/1  ydslnllpewaripwdndrelleaweeGrTgyplvdaamrqlvatGymhnrlRmivasfltklllldWrl
00486541   1/1  ----------------------------------------------------------------------
00463641   1/1  ----------------------------------------------------------------------
00484111   1/1  ----------------------------------------------------------------------
00474211   1/1  ----------------------------------------------------------------------
00497821   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GERHFADRLVDYDPANNAANWQWTASTGTDTVAVRIFDPVSQMAKYDSDAAFVTEYVPELRGVDPETIVD
00415001   1/1  WrlgaewFlelliDyDlasNvggwqwvAgtgtdapyfrifnpvkqaekfdpngeYirrwvpelaslpgey
00365121   1/1  lgaewFlelliDgdlannyggwqwvagggtdakpyfrifnpikqakkfdpdgeYirrwvPeladlpfeyi
00441991   1/1  dWrlgaewflelllDgdlasnyggwqwvagtgtdafpyfrifnpvkqarkfDpdgeYirrwvPeladlpt
00486531   1/1  lgaewflelllDgdlasnyggwqwvagtgtdapyfrifnpirqmskfDpdgeyirrwvPeladlpdkyih
00391381   1/1  gaewflrlllDgdlannyggwqwvagggldakpyfrifnpvkqgrkfdpdgeyirrwvPelanlp.....
00486541   1/1  ----------------------------------------------------------------------
00463641   1/1  ----------------------------------------------------------------------
00484111   1/1  ----------------------------------------------------------------------
00474211   1/1  ----------------------------------------------------------------------
00497821   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           WPTLRHSQRERLAPDYHHPIVDRDHAYERAQRVFEAALDGDA----------------------------
00415001   1/1  ihepweaplfvliragvvlgldyplpivdlaear------------------------------------
00365121   1/1  hepwlap..agvrlgknyplpivdlklarkralellkil-------------------------------
00441991   1/1  eyihepwkaplevleaagvvlgldypapivdhkearkralray---------------------------
00486531   1/1  epwka.....vllgldYpapivdhkearkralrlllalrkl-----------------------------
00391381   1/1  ................ypdpivdhkeareralrlyk----------------------------------
00486541   1/1  ----------------------------------------------------------------------
00463641   1/1  ----------------------------------------------------------------------
00484111   1/1  ----------------------------------------------------------------------
00474211   1/1  ----------------------------------------------------------------------
00497821   1/1  ----------------------------------------------------------------------