[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for halo0:AAG19982.1


[Show Plain Result]

## Summary of Sequence Search
   1::536
  19::515    9e-41 27.6% 0043577 00435771 1/1   AD(P)-binding domain                    
  26::510  1.9e-40 25.2% 0048494 00484941 1/1   AD(P)-binding domain                    
  19::301  7.3e-40 29.5% 0044413 00444131 1/1   AD(P)-binding domain                    
  19::367  1.2e-38 26.5% 0040660 00406601 1/1   AD(P)-binding domain                    
  19::512    3e-36 28.2% 0036092 00360921 1/1   AD(P)-binding domain                    
  27::510  8.8e-36 28.5% 0045870 00458701 1/1   AD(P)-binding domain                    
  19::513  1.1e-32 25.8% 0049150 00491501 1/1   AD(P)-binding domain                    
  26::513  4.2e-31 27.7% 0048771 00487711 1/1   AD(P)-binding domain                    
  19::510  6.5e-31 28.1% 0037441 00374411 1/1   AD(P)-binding domain                    
  19::510    1e-30 30.8% 0046446 00464461 1/1   AD(P)-binding domain                    
  19::510  1.2e-30 29.0% 0040035 00400351 1/1   AD(P)-binding domain                    
  26::510  9.1e-30 24.8% 0047022 00470221 1/1   AD(P)-binding domain                    
  27::296  2.5e-29 32.3% 0052963 00529631 1/1   AD(P)-binding domain                    
  19::513  6.6e-28 30.0% 0046270 00462701 1/1   AD(P)-binding domain                    
  19::372  1.5e-27 27.1% 0047327 00473271 1/1   otide-binding domain                    
  19::512  5.1e-27 28.1% 0041341 00413411 1/1   AD(P)-binding domain                    
  24::308  6.2e-27 24.2% 0046274 00462741 1/1   AD(P)-binding domain                    
  19::377  7.1e-27 28.2% 0050363 00503631 1/1   AD(P)-binding domain                    
  19::512  1.2e-26 28.6% 0045518 00455181 1/1   AD(P)-binding domain                    
  26::512  1.5e-26 25.4% 0049990 00499901 1/1   otide-binding domain                    
  24::509  2.4e-26 27.4% 0046514 00465141 1/1   AD(P)-binding domain                    
  26::512  4.5e-26 31.0% 0046057 00460571 1/1   otide-binding domain                    
  28::427  7.4e-26 25.7% 0046579 00465791 1/1   AD(P)-binding domain                    
  19::513  1.3e-25 28.0% 0049003 00490031 1/1   AD(P)-binding domain                    
  28::314  1.4e-25 30.0% 0045881 00458811 1/1   AD(P)-binding domain                    
  23::512  1.5e-25 24.2% 0047029 00470291 1/1   AD(P)-binding domain                    
  26::513    1e-24 28.8% 0052926 00529261 1/1   AD(P)-binding domain                    
  23::312  4.6e-24 22.7% 0046128 00461281 1/1   AD(P)-binding domain                    
  24::311  4.6e-24 27.3% 0047682 00476821 1/1   AD(P)-binding domain                    
  19::509  8.6e-24 27.0% 0040688 00406881 1/1   AD(P)-binding domain                    
  19::510  4.8e-23 25.4% 0035989 00359891 1/1   AD(P)-binding domain                    
  19::433  2.5e-22 32.8% 0049222 00492221 1/1   AD(P)-binding domain                    
  25::310  1.8e-21 33.3% 0052313 00523131 1/1   AD(P)-binding domain                    
  19::509  2.2e-21 32.6% 0040602 00406021 1/1   AD(P)-binding domain                    
  25::509  2.6e-21 28.2% 0038074 00380741 1/1   AD(P)-binding domain                    
  26::512  7.1e-21 28.7% 0052032 00520321 1/1   AD(P)-binding domain                    
  27::417  1.2e-20 25.0% 0045795 00457951 1/1   otide-binding domain                    
  26::296  1.6e-20 30.7% 0047564 00475641 1/1   AD(P)-binding domain                    
  19::353  2.6e-20 28.9% 0039664 00396641 1/1   AD(P)-binding domain                    
  19::395  3.1e-20 27.5% 0048356 00483561 1/1   AD(P)-binding domain                    
  24::510  5.2e-20 33.9% 0036300 00363001 1/1   AD(P)-binding domain                    
  19::510  1.2e-19 28.5% 0046416 00464161 1/1   AD(P)-binding domain                    
  27::509  1.2e-19 28.7% 0046834 00468341 1/1   AD(P)-binding domain                    
  23::510  1.5e-19 31.4% 0048199 00481991 1/1   AD(P)-binding domain                    
  28::296  2.6e-19 33.1% 0048607 00486071 1/1   AD(P)-binding domain                    
   1::360  2.2e-18 28.0% 0052911 00529111 1/1   AD(P)-binding domain                    
  25::509  2.2e-18 27.2% 0047712 00477121 1/1   AD(P)-binding domain                    
  19::296  3.6e-18 42.2% 0036459 00364591 1/1   otide-binding domain                    
  25::296  5.3e-18 29.9% 0047133 00471331 1/1   AD(P)-binding domain                    
  23::510  2.2e-17 29.7% 0044098 00440981 1/1   AD(P)-binding domain                    
  26::510  2.3e-17 23.7% 0052600 00526001 1/1   AD(P)-binding domain                    
  23::296  3.1e-17 45.3% 0047141 00471411 1/1   otide-binding domain                    
  27::297    5e-17 41.1% 0036889 00368891 1/1   AD(P)-binding domain                    
  27::300  1.1e-16 30.5% 0042446 00424461 1/1   AD(P)-binding domain                    
  26::296  2.4e-16 41.3% 0037643 00376431 1/1   AD(P)-binding domain                    
  26::310  2.4e-16 41.2% 0048807 00488071 1/1   otide-binding domain                    
  23::296  2.8e-16 33.6% 0047270 00472701 1/1   AD(P)-binding domain                    
  26::290  3.3e-16 28.6% 0048583 00485831 1/1   AD(P)-binding domain                    
  27::297  3.6e-16 38.9% 0047565 00475651 1/1   AD(P)-binding domain                    
  24::516    6e-16 24.8% 0053321 00533211 1/1   AD(P)-binding domain                    
  27::300  9.3e-16 43.0% 0048866 00488661 1/1   AD(P)-binding domain                    
  24::296    1e-15 37.3% 0045797 00457971 1/1   AD(P)-binding domain                    
  27::300  2.9e-15 40.9% 0053322 00533221 1/1   AD(P)-binding domain                    
  27::300  3.9e-15 39.8% 0048009 00480091 1/1   AD(P)-binding domain                    
  27::300  5.2e-15 44.4% 0048045 00480451 1/1   AD(P)-binding domain                    
  19::510  6.7e-15 27.1% 0046760 00467601 1/1   AD(P)-binding domain                    
  26::299  6.9e-15 41.5% 0048365 00483651 1/1   AD(P)-binding domain                    
  27::299  6.9e-14 44.8% 0044705 00447051 1/1   AD(P)-binding domain                    
  27::299  7.2e-14 40.2% 0036654 00366541 1/1   AD(P)-binding domain                    
  19::296  1.1e-13 32.2% 0040049 00400491 1/1   AD(P)-binding domain                    
  27::300  2.9e-13 37.0% 0038449 00384491 1/1   AD(P)-binding domain                    
  26::296    5e-13 32.6% 0046156 00461561 1/1   otide-binding domain                    
  27::300  7.6e-13 43.2% 0047271 00472711 1/1   AD(P)-binding domain                    
  28::296    8e-13 43.4% 0050961 00509611 1/1   AD(P)-binding domain                    
  27::300  5.9e-12 37.6% 0048200 00482001 1/1   AD(P)-binding domain                    
  27::300  8.2e-12 40.7% 0049679 00496791 1/1   AD(P)-binding domain                    
  16::300  8.7e-12 39.0% 0038468 00384681 1/1   AD(P)-binding domain                    
  22::296  1.4e-11 37.3% 0050148 00501481 1/1   AD(P)-binding domain                    
  27::291  1.4e-11 38.9% 0050927 00509271 1/1   AD(P)-binding domain                    
  25::296  2.1e-11 38.8% 0046750 00467501 1/1   AD(P)-binding domain                    
  27::296  2.9e-11 42.5% 0045519 00455191 1/1   AD(P)-binding domain                    
  27::335  3.6e-11 26.2% 0047909 00479091 1/1   )-binding Rossmann-fold domains         
   5::300  3.8e-11 34.2% 0046972 00469721 1/1   AD(P)-binding domain                    
  17::296  4.2e-11 30.8% 0047068 00470681 1/1   AD(P)-binding domain                    
  27::301  4.7e-11 36.2% 0048584 00485841 1/1   AD(P)-binding domain                    
  27::296  8.4e-11 36.8% 0050364 00503641 1/1   AD(P)-binding domain                    
  27::300  9.6e-11 36.3% 0036301 00363011 1/1   AD(P)-binding domain                    
  25::103    2e-10 39.4% 0048016 00480161 1/1   otide-binding domain                    
  25::296  2.7e-10 35.3% 0048865 00488651 1/1   AD(P)-binding domain                    
  27::119  2.7e-10 33.7% 0050960 00509601 1/2   AD(P)-binding domain                    
  22::116  2.1e-09 26.7% 0045481 00454811 1/1    N-terminal domain                      
  18::296  3.3e-09 33.3% 0040619 00406191 1/1   AD(P)-binding domain                    
  27::296  5.6e-09 32.4% 0048364 00483641 1/1   AD(P)-binding domain                    
  27::342  4.6e-08 38.3% 0046344 00463441 1/1   AD(P)-binding domain                    
  27::301    2e-07 36.2% 0046761 00467611 1/1   AD(P)-binding domain                    
  27::310  9.5e-07 31.9% 0037437 00374371 1/1   )-binding Rossmann-fold domains         
  24::59   2.8e-06 54.5% 0042342 00423421 1/1   )-binding Rossmann-fold domains         
  27::78   3.8e-06 46.2% 0048108 00481081 1/1   AD(P)-binding domain                    
   5::66   7.1e-06 37.7% 0046973 00469731 1/1   AD(P)-binding domain                    
  17::122  9.8e-06 31.6% 0052964 00529641 1/1   AD(P)-binding domain                    
  27::63   1.9e-05 48.6% 0041940 00419401 1/1   AD(P)-binding domain                    
   8::93   3.7e-05 20.0% 0047278 00472781 1/1   )-binding Rossmann-fold domains         
  26::56   5.8e-05 45.2% 0044559 00445591 1/1   )-binding Rossmann-fold domains         
  16::61   7.5e-05 39.1% 0038285 00382851 1/2   AD(P)-binding domain                    
  27::61   9.1e-05 38.2% 0046357 00463571 1/1   )-binding Rossmann-fold domains         
  23::61   0.00011 46.2% 0045798 00457981 1/1   AD(P)-binding domain                    
  23::65   0.00013 41.9% 0050443 00504431 1/1   )-binding Rossmann-fold domains         
  18::69   0.00014 34.6% 0036016 00360161 1/1   AD(P)-binding domain                    
  27::65   0.00014 41.0% 0047276 00472761 1/1   )-binding Rossmann-fold domains         
  27::56   0.00028 40.0% 0048227 00482271 1/1   )-binding Rossmann-fold domains         
  27::77   0.00034 30.4% 0047510 00475101 1/1   )-binding Rossmann-fold domains         
  28::59   0.00043 46.9% 0053383 00533831 1/1   )-binding Rossmann-fold domains         
  23::56   0.00067 38.2% 0046673 00466731 1/1   )-binding Rossmann-fold domains         
  27::56   0.00087 46.7% 0035535 00355351 1/1   )-binding Rossmann-fold domains         
 212::296      6.6 25.9% 0050960 00509602 2/2   AD(P)-binding domain                    
 250::299       10 28.0% 0038285 00382852 2/2   AD(P)-binding domain                    
   1::536


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPHQSQPGFLLPAIQHHSMQGSLPGERDVTVVGGGFGGLAAAAYLARAGASVTLLEQHDTVGGRAGVLER
00435771   1/1  ------------------M.......kdVaviGAGiaGlaaAyeLaraGlkVtvlEardrlGGrsrtvgy
00484941   1/1  -------------------------aakkydvvIiGaGpaGlaaAlrLaraGlkVtvlEkgdrlGGrsrt
00444131   1/1  ------------------Ms...dedyDviviGaGiaGlvaAarLakaGlkVlvlEkgdrlGGtaatlgl
00406601   1/1  ------------------Mdd.lpeeyDVvViGaGlaGlaaAaaLaraGlrVlvlEkrdrlGGtsatsry
00360921   1/1  ------------------pplmmdeeydvvViGaGpaGlaaAlrLaraGlkVlvlEr....gGrlasgri
00458701   1/1  --------------------------ydVvvvGAGiaGlaaAlrLaeaGltdvlvlEagdrvGGrartvr
00491501   1/1  ------------------MirvcpalceslvvlaaglepplpplsaskkkdvvviGaGpaGlaaAyrLar
00487711   1/1  -------------------------kydvviiGaGiaGlsaAleLarrGlkdVtvlErgplpggggasgr
00374411   1/1  ------------------MpvligllesliidtalllgllpplsaskkydvvviGaGpaGlaaAleLara
00464461   1/1  ------------------MmplslllatalelplpalaldkkyDvvViGaGpaGlaaAlalaraGlkVll
00400351   1/1  ------------------M......eyDvvvvGaGpaGlaaAlrLaraGlkVlvlErgdrpGGtsltngg
00470221   1/1  -------------------------myDVvviGgGiaGlaaAlrLaraGlkVlvlEagdrlGGrlrtvrl
00529631   1/1  --------------------------mptkkdVaiIGAGpaGLaaAllLaraGhdldVtvfErrdrpGGl
00462701   1/1  ------------------MMsplllalllllpllllaldeeydvvviGaGpaGlaaAlalaraGlkVlll
00473271   1/1  ------------------M.......yDviviGaGiaGlaaAyrLakaGlkVlvlEkgdrlGGraatfrl
00413411   1/1  ------------------Mp.msseeyDvvViGaGpaGlaaAlrlaraGlkVlllEkgpvlgGtssrn.q
00462741   1/1  -----------------------mlMkkkyDviiiGaGpaGlaaAleLaraGlkVlvlEkgdrlGGtwas
00503631   1/1  ------------------ma.smsmkydvvIiGaGpaGlaaAlrLaraGlkvtvlEkgprlGgtwrtgry
00455181   1/1  ------------------Ms.....eydvvviGgGpaGlaaAlrlaeaGlkvlvlEkgdrlgglsnrngi
00499901   1/1  -------------------------kkdvvviGAGiaGlaaAlrLaeaGhkVtvlEardriGGrsrtngg
00465141   1/1  -----------------------eieydvvViGaGpaGlaaAlrlaraGlkVtviEkgprlggclnvgci
00460571   1/1  -------------------------pmmskkkdvvViGaGiaGlsaAlaLaraGysVtvlErgdrpggts
00465791   1/1  ---------------------------mkeyDvvIiGaGiaGlsaAlrLakaGlkVlvlEkgdrpGgrga
00490031   1/1  ------------------lMlpeslleplpalsaseeydVvViGaGpaGlaaAlalaraGlkVlllEkgp
00458811   1/1  ---------------------------llydvvIiGaGpaGlsaAlrLaraGlkVlvlEkGplvnrdrlG
00470291   1/1  ----------------------lllllslsllllllsslllmmskeyDvviiGaGpaGlvaAlrLaelaG
00529261   1/1  -------------------------lniksielflsiieraldeglvppsmemmmekydvvIiGaGpaGl
00461281   1/1  ----------------------glellllslltemmskeyDvvvvGaGpaGlvaAlrLaedaGlkVlvlE
00476821   1/1  -----------------------lallslllllllglllalpdlamdkeyDvvvvGaGpaGltaAlrLae
00406881   1/1  ------------------Ms...skeydvvviGgGpaGlaaAlrlaraGlkvlllekgdrlgglllagci
00359891   1/1  ------------------Mk.eldeeyDvviiGaGpaGlsaAlrLaraG.kVlvlEkgpvlggtsglngg
00492221   1/1  ------------------MmktpvliklleslladtalrlpplpplsldeeyDVvvvGAGpaGlaaAyeL
00523131   1/1  ------------------------msydVvvvGAGiaGlsaAlaLarrGlrvlllergdvlggascrnsg
00406021   1/1  ------------------Ms.....eyDvvvvGaGpaGlaaAlrlaraGlkvlllEkgdrlggtsllggg
00380741   1/1  ------------------------keydvvviGgGpaGlaaAlrlaraGlkvlllekgdlgggclnvgci
00520321   1/1  -------------------------MmdeeyDvviiGaGpaGlsaAlrLaraGlkVlvlEkgpllggtsg
00457951   1/1  --------------------------yDVvIiGaGpaGlsaAlrLaraGldlgselkVtvlEkgdrlGGt
00475641   1/1  -------------------------lldkeyDVvviGgGpaGlaaAlrlaraGlkvlllEkgdrlgGtcl
00396641   1/1  ------------------MsylasaallaalpslletieyDVlviGgGpaGlsaAlelarlapdaGlkVa
00483561   1/1  ------------------M....skkydvviiGaGiaGlsaAlrLaraGlkVlllEkgdrlGGtsgrnag
00363001   1/1  -----------------------mekydvvviGaGlaGlsaAlelaragldvtvlergprlggcllllsv
00464161   1/1  ------------------M.....leydvvviGgGpaGlaaAlrlaraGlkvlliekgdrlGGtllntgc
00468341   1/1  --------------------------smasesdydvvIiGaGpaGlsaAlrLaralgklpGlkVtvlEkg
00481991   1/1  ----------------------klllatgslplipplegllldgvlllrtlldalallemlkkeydvvvi
00486071   1/1  ---------------------------myDvviiGaGpaGlaaAlrLaraGlkVlvlEk.drlGGtc..l
00529111   1/1  llsnlplgrllpfllptslwldtlplpllellisraileralpdldmdkeyDVvIvGAGpaGLsaAyyLa
00477121   1/1  ------------------------ektdVaIvGAGpaGlaaAlaLaraGldvtvlErrdrpggtalgrgg
00364591   1/1  ------------------mgrvcppcegaclllllagpvailllepaladelllgllplllpamskkkdv
00471331   1/1  ------------------------tmkydvviiGaGpaGlaaAlrlaraGlkvlllEkgprlgyktllal
00440981   1/1  ----------------------MeskkydvvviGaGpaGlaaAlylaraglkvtllekgprlggllntgc
00526001   1/1  -------------------------MseeyDvvvvGaGpaGltaAleLaraGlkVlllEagdrvgGtslr
00471411   1/1  ----------------------mstkkdvaiiGaGpaGlsaAiyLaraGlddvtvlEkndrlgGrll.gg
00368891   1/1  --------------------------ppipglellltsddalellelpkdvvviGgGpaGleaAlalarl
00424461   1/1  --------------------------vPrvlpipgidlggvlhaldfldpkalkgkkVaviGaGpaGlaa
00376431   1/1  -------------------------eydvvvvGaGpaGlaaAlalaraglkvlllekgprlggllvglip
00488071   1/1  -------------------------irvcilcelacllllllgpvlilllelaaalllpllllpatkkkd
00472701   1/1  ----------------------ledllldllsmstkkdvvviGaGpaGleaAlalarlglkvtlierg..
00485831   1/1  -------------------------lsedkeyDVvviGgGpaGlaaAlalaraGlkVlllEkgpelggtc
00475651   1/1  --------------------------pipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalar
00533211   1/1  -----------------------mekydvviiGaGpaGlaaAlrlaraGlkvlvlEkgprpgglsrlngg
00488661   1/1  --------------------------srprvlpipgldlegvlllrtlldsdallellalpkdvvviGgG
00457971   1/1  -----------------------sekydvviiGaGpaGlaaAlrlarlaglkvlliekg.rlggllllla
00533221   1/1  --------------------------ipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarl
00480091   1/1  --------------------------ppipglegvltsrdlldllelpkdvvviGgGpaGleaAlalarl
00480451   1/1  --------------------------pgldlelvltsddlldleelpkdvvviGgGpaGleaAlalarlg
00467601   1/1  ------------------M.....keyDvvviGaGpaGlaaAlrlarlgldkvlviekgpllggqtllll
00483651   1/1  -------------------------ipgldlpgvlllltsddalallellllakpkdvvviGgGpaGlea
00447051   1/1  --------------------------arprllpipgedlflgkgvltsatilgalllfkgkdvvviGgGp
00366541   1/1  --------------------------vlpipgldgegvltsrdlldllelpkdvvviGgGpaGleaAaal
00400491   1/1  ------------------Mk...dleyDvvvvGaGpaGlaaAlalaragpdlkvaliekgplgggascln
00384491   1/1  --------------------------lpgvellltsddalaleelpkdvvviGgGpaGleaAlalarlgl
00461561   1/1  -------------------------gkkvaviGaGpaGlaaAllLakalpghdvtvfEkgpvpggllry.
00472711   1/1  --------------------------PrlpdipglelflgkgvhtsatldgllfkgkdvvviGgGpaGle
00509611   1/1  ---------------------------lPrllpipglegvlllrtlldsdlllellelpkdvvviGgGpa
00482001   1/1  --------------------------llpipglevltsdgaldllelpkdvvviGgGpaGleaAlalarl
00496791   1/1  --------------------------PgipgleeflgkgvhtsatldglefrgkdvvviGgGpaGleaAl
00384681   1/1  ---------------ftprvlpipgeeacglltadepvailflerlihsyavkdgppftgkdVaViGaGp
00501481   1/1  ---------------------lmeleydvvviGgGpaGlaaAlylaraglkvtliekgplllyalgglll
00509271   1/1  --------------------------vydvviiGaGpaGlaaAlrlaraglklsevlllek.drlggtil
00467501   1/1  ------------------------kkkdvvvvGgGpaGltaAlrlarlgpdlevtliekgdrlggtpllp
00455191   1/1  --------------------------ppipgvellltsddalalkelpkdvvviGgGpaGleaAlalarl
00479091   1/1  --------------------------mmsylplfldlkgkrVliiGgGpaGltaAlelakaGakvtlver
00469721   1/1  ----dlpgve.llltsddalalkelpkdvvviGgGpaGleaAlalarlgakvtliergdrllglld....
00470681   1/1  ----------------lllllmmmlhydvvviGgGpAGlaaAlrlarldpgarvlliekepglgy.....
00485841   1/1  --------------------------rPrvppipgldlvltsddlldleelpkdvvviGgGviGleaAla
00503641   1/1  --------------------------epklPdipGledFkgelfhsarwphdlvdltgkrVaviGaGpaG
00363011   1/1  --------------------------ppipgldlegvftlrtlddalalreallagkrvvvvGgGlaGle
00480161   1/1  ------------------------tgkkVavvGaGpAGlaaAaqLaraldlseelghdvtvferlprpgg
00488651   1/1  ------------------------mlpkdvviiGgGpaGleaalalarlglklevtliergdrlggtl.l
00509601   1/2  --------------------------kdvvviGgGpaGleaAlalar.glkvtliergdrlggt......
00454811   1/1  ---------------------tdlkgkrVvViGaGlsGlaaarlllrlGaevtvldrrdrpggl..llle
00406191   1/1  -----------------prvlpipGedlcgvlslrdfvgdynlhpaawllppdltgkrVvviGaGpaGld
00483641   1/1  --------------------------ydvviiGgGpaGltaaiylarlgpdlkvtliekggtclyvgcll
00463441   1/1  --------------------------krVlVvdgGgGpaGleaAealarrGheVtlvealdrlggll...
00467611   1/1  --------------------------gvlllltsddalalkelpkdvvviGgGyiGleaAlalarllpeg
00374371   1/1  --------------------------agrlavleaalllervltglgalagllpgkrvlViGaGgiGlea
00423421   1/1  -----------------------ldllplfldlrgkdvlviGgGdvGlaaarllleaga-----------
00481081   1/1  --------------------------aalliliaslglellpadylvlaigssdgaldlpklpkrvvvvG
00469731   1/1  ----dipgle.llltsddalalkelpkdvvviGgGyiGleaAaalarlgaevtlvergdrllpyld----
00529641   1/1  ----------------ePripdipglleefkgkvlhsaayrdpedfkgkrVvViGaGaSgldialelakv
00419401   1/1  --------------------------lPdipglelvltsddalelkepkkvvviGgGyiGlea-------
00472781   1/1  -------ldifvkrlikelivvklpgkkvvviGaGpvGlalAlalallgavgkVvlvdideekle.glal
00445591   1/1  -------------------------pkkvaviGaGgvGlalAlllaaagggdVtlv--------------
00382851   1/2  ---------------srPrvlpipgldlegvlllrtledalellellelpkrvvviGgGli---------
00463571   1/1  --------------------------mKiaviGaGyvGlelAavla.lgheVtlvdinpek---------
00457981   1/1  ----------------------iPglelvltsddaldleelpkrlvviGgGyiGlelAsal---------
00504431   1/1  ----------------------lmeikkvaviGaGlmGlgiAavlaraGleVvlvdinpealera-----
00360161   1/1  -----------------prklgiPGedlpgvfsardfvawynglpdaallepdltgkrVvviGgGpaGl-
00472761   1/1  --------------------------ysrplllgligllgakvlpgkkvaviGaGgvGlalAlal-----
00482271   1/1  --------------------------mkiaviGaGyvGlplAallaeaGheVvgvD--------------
00475101   1/1  --------------------------sepiadtvlvlilnllrdllgarqrlsagllrlkpllglelkgk
00533831   1/1  ---------------------------lellgvallevlgkrilkgkkvaviGaGgvGl-----------
00466731   1/1  ----------------------mlkikkvaViGaGlmGsgiAavlaaaGikVvlvD--------------
00355351   1/1  --------------------------GkkvaviGlGsmGlalAallaaaGheVlvw--------------
00509602   2/2  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DGFRFDTGPSWYLMPDVFERFFDHFDHDPHDFYELTRLDPQYRVFWTDGDSATIEPNRRNAHELFESYEE
00435771   1/1  pgfrldlgaglipgsypyllelleelglelair...lntevggavllpdgglltvprdladllaellala
00484941   1/1  ggypgfpiidsgallf..pellpyllellkelglelrl..pdlggrvvvlpdgkvlgyd...........
00444131   1/1  dglkfdlggsvihgllypallrllrklgldlgpkilhalgelvdlllrtdvsdylefrlldgrvv..fpd
00406601   1/1  pGfrfdvggsllpgti..pgllrllrelgledlellplglagvirgggsvvnalpdeaeallaelgvlfp
00360921   1/1  pgklldggahll..pglleellaglg....dlaellalkpelvalledgaailllprgvrllaglglggs
00458701   1/1  ypgfrfdlgahvflgpggelleylldlleelgleddlrlntevggarlllpdgkllvltsdlnal.....
00491501   1/1  aGlkVtvlEardrlGGrsrtaglippgflldlgahvfpglaplllelleelgle....lelltlagaavl
00487711   1/1  nagllhaglaylelarlare..................................................
00374411   1/1  GlkVtvlEardrlGGrlrtaripglgasldlggilfpglsprllellaelgle....aelarllglrvli
00464461   1/1  lEkgdrlGGtslta..ggilldlgarlleglglldlleelleelgielr..llrdgklvvaltg......
00400351   1/1  pgfkldlgaalllg....pelleelgteaaellaergvrvlrgkg..lgggstin...............
00470221   1/1  gggtsldlggivfpglypallelleelglelallaldg..ellayldglvlelgidlntl.vvaldpdal
00529631   1/1  wrttgrigsgldlgpsllrlleelglldelleeglsplypglrldvpkel....................
00462701   1/1  EkgdrlGGtslrs..ggilldgglrlleglglldrleelleelgield..llvdgrlvvalad.......
00473271   1/1  dgfrvdnvgahpfkgl..npelldllkelg....ledkldl.rrlvllrg....................
00413411   1/1  ggirldlgaipl...dlleelgldl.............................................
00462741   1/1  ngipgipsdggaavilgpellellrelgi.elgpkvpeildyllklldkfdllklleflskvngveyieg
00503631   1/1  pglllllpallyllldlpllf.................................................
00455181   1/1  pglrlllgalllrllelleelgipfdlpglgglflprggrvdg...........................
00499901   1/1  llipglrldlgahlfpgsyellldlleelgvel.......rlntrvvvdr.dgklvtvpldldglelead
00465141   1/1  pgkaldaaalllrllelleelgvelrlppldglllpgvgdvl............................
00460571   1/1  gtnggllaaglvapllllpggipllalalealdllrelglelgidf......rvgalvlatglaela...
00465791   1/1  sgrnaggiapglgy.ddrllalakeslellkelgaelgidlfrppgklvvaggg.diglllelaealrrl
00490031   1/1  rlggtscln..ggglppgglrylaglglldlleelaeelgidld...flrdgllvlaldg..........
00458811   1/1  Gts..nggdg.rldlgahvfflllppgllellaelglplglelldlleelleelgidfllgkgvg.glsa
00470291   1/1  lkVlvlEa....GGtarnggyigskpdlgaalfg..elldelyelgle...........ldgrrllfprg
00529261   1/1  aaAlrLlqlAaraGpdlkVtvlEkgdrlGGtsrtnggliprgleelldelgipgalldagfpydgllfvf
00461281   1/1  agdrlgGascipsgaglgadlgltll..pglfdtll........agldgrdllarrgkvlggsslingmv
00476821   1/1  .GlkVlvlEaggrlggrgatpsgggflvdtgadwlfgtep..................elglegrgillp
00406881   1/1  pgkallaaalllrllellaelgiellllpypgvdlslv................................
00359891   1/1  gipgglllddllerlgedlliglallvdgdlvvvltgegleadalllatGapprlldipgldelggllsl
00492221   1/1  arapGlkVlvlEkgdrlGGts...rnggvipdgglldpelldlleel..Glpfdl...............
00523131   1/1  gglakgllleelpal.......................................................
00406021   1/1  llnagdildklgllaallvrl.................................................
00380741   1/1  pgkrllaaaelydelrelleelgipfdevllglllllgrggadg..........................
00520321   1/1  ln.gggihaglskllldlrdlleelgvelllggaglvdprgvellge.......................
00457951   1/1  sglnaglippglggplddrglalaeetlellrelgaelglldglvrpngalvl.................
00475641   1/1  nsgcipskalllaalglllllgaalfglllllllllldlvllgaakralgae..................
00396641   1/1  lvEkgdlgggasgrsgggiaaglrll..ienylgldlaellvedlvkgga.....glvdedlveilatga
00483561   1/1  lipgglrldaall.........................................................
00363001   1/1  pggrldp...............................................................
00464161   1/1  ipgkalllgalllellrellelgglflllpdldlelllelldalv.........................
00468341   1/1  prpggrs....rggglypgglellrelgledeleelgvdflkalvvlldldlv.................
00481991   1/1  GgGpaGlaaAaylarlGlkvlliekgprlggtclnvgcipskallkaaelaeliellpglgvelllgglg
00486071   1/1  nvgcipskallyagllpdelelleelglpl.lpgldipvlpgrkgg........................
00529111   1/1  karPglkVlvlEkgdrpGGas.......grnggilpsglltdellelleelgipfdpe............
00477121   1/1  alsprglelleelglldallargvpldglvvvdgggrlaldfaelalgapg..yvvdr............
00364591   1/1  vvvGaGpaGlaaAlalaraGlkvtllekgdrlggrlllvg..............................
00471331   1/1  Ggllltvglipgkallgaall......lelaelleelgvevtllellggdrvlprldldg..........
00440981   1/1  gpsklllpgall..........................................................
00526001   1/1  n........gglphkglreladrlielleelgvelllntvvgalltlaellaeydavvlalglglatgla
00471411   1/1  ipg...................................................................
00368891   1/1  glkvtliergdrlgglld....................................................
00424461   1/1  AlyLarlGaevtvierrprlggtllalgrip.....akllglealllrllllllglglll..........
00376431   1/1  sklll.................................................................
00488071   1/1  vaviGaGpaGlaaAlalaraGlkVtllEardrlggrlllsgg............................
00472701   1/1  lGgtl.lnggpglskpll....................................................
00485831   1/1  laaggipskallllalgllllelaallgillllllld.................................
00475651   1/1  lgakvtvvereprlggtld...................................................
00533211   1/1  ggaaldlp..sklllrlldll.................................................
00488661   1/1  paGleaAaalarlgakvtlvergdrlggtlld......................................
00457971   1/1  yggil.................................................................
00533221   1/1  gaevtvvergdrlgglld....................................................
00480091   1/1  gaevtvvergdrlgglld....................................................
00480451   1/1  akvtlverrdrlgglld.....................................................
00467601   1/1  ggtclnvgcipskllllaallpellelleglgvefdleekgvdldglrlaydklv...............
00483651   1/1  AlalarlGakVtviergdrlggrll.............................................
00447051   1/1  aGleaAlylarlgakvtlierrdrlggtl.........................................
00366541   1/1  arlgakvtvvergdrlggtld.................................................
00400491   1/1  gg......gipakllledllerlvvdll......kggailvdedlvelldge..................
00384491   1/1  kvtvver.drlggtl.......................................................
00461561   1/1  ......................................................................
00472711   1/1  aAlalarlglkvtllerrprlggtl.............................................
00509611   1/1  GleaAlalarlglkVtliergdrlgg.ld.........................................
00482001   1/1  glkvtlvergdrlggtl.....................................................
00496791   1/1  ylarlglkvtlierrdrlggd.................................................
00384681   1/1  aGldaAlylarlgakkvtlverrdrlg...........................................
00501481   1/1  yvgcilskall...........................................................
00509271   1/1  ......................................................................
00467501   1/1  gvlggk................................................................
00455191   1/1  gakvtlierrdrllgtl.....................................................
00479091   1/1  dpr...................................................................
00469721   1/1  ......................................................................
00470681   1/1  ...........nrgclpkklllaaaelldlllelaglgll..............................
00485841   1/1  larlgakvtvvergdrllgtld................................................
00503641   1/1  laaaaelakaglevtvfertprigglwr..........................................
00363011   1/1  aAaalrrlglevtlvergdrlllpyl............................................
00480161   1/1  ll........rygiapdfrlpkevvdrlvdlle-------------------------------------
00488651   1/1  plgpgpll..............................................................
00509601   1/2  rpllsgvipgklldeelaeylrelleklgvevllgtevtsidgdgkgvt---------------------
00454811   1/1  lgvefvlgslllellleadlvvlspgvpldhpllelarelgievig------------------------
00406191   1/1  aArellkdldlllktdisdnaleallarlgaevtvvgRrgpliaaftlkelerlpelggllry.......
00483641   1/1  skalg.................................................................
00463441   1/1  ......................................................................
00467611   1/1  akvtlvergdrllpcld.....................................................
00374371   1/1  AaalarlGakVtvvd.......................................................
00423421   1/1  ----------------------------------------------------------------------
00481081   1/1  gGyiGlel--------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00529641   1/1  aksvtllersdelggpw.............................lgvvil------------------
00419401   1/1  ----------------------------------------------------------------------
00472781   1/1  elidillpklvdvvvttelkevl-----------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00457981   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00475101   1/1  kvviiGa---------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GAGDALATYLDRAATNYDLAMNRVVYPDRTAFRDYASTDMLPLASRLRLFGNMDDYVSRFFDHPKLRQLL
00435771   1/1  dgllleadavilAtGarprlppipgldlkgvlts.....rdll..dllgkrvvviGgGasgldiaealar
00484941   1/1  .....lglgalpdspealgleefpgrvvvigggyiglelagkrvrvggakvtllqrrppfvlpllllgll
00444131   1/1  gkvlkvptnlaellksfllglsekrrllaflgviat....................gdrpralgipgldl
00406601   1/1  igyaellpfyerleklygvlg.egylpdlpgasifkglpvhssfddreldldgkrvvvigsgasavraka
00360921   1/1  sainagvylrvspadfdel..gawgvtlddlepyfelaadalvlatGsrprlpplpgl.elggv.lltaa
00458701   1/1  ....................................llelradalilatgal..prlppipgldlgevlh
00491501   1/1  alldgklidlpadvarllaarlvrlldgleleadalilatGarprlllpipgldlfgvlgrvllssdlll
00487711   1/1  ....................sldllrelveelgidfrrygklvlatgeaelellrelaealralgvdvel
00374411   1/1  lldgtvvsldgdld.........................fevlladgeeleadalilatGarprllpipg
00464461   1/1  ......................................................................
00400351   1/1  .............adavvlatg..adprllgipgldydfllpgvhsaedalgldllgkrvvviGggysgv
00470221   1/1  evlledleelradavvlAtGsrprlppipgedlggvlhsallldll..gkrvvvigggasgldlaellar
00529631   1/1  ...............................................................ygfpdfp
00462701   1/1  ......................................................................
00473271   1/1  .............kvlggpsdlngllavrgdedlleakalllatgpylpllpgl.sleevldsllgldll
00413411   1/1  .......................vkggdgltleagalvlatgarpripplpglgvpgvltsdgalalrep
00462741   1/1  r..............................................asfldagkwevltedgwgifeee
00503631   1/1  ......................................................................
00455181   1/1  ......................................................................
00499901   1/1  avvlatGalsl..............................lprlpdipgldlf.sleellsalglldll
00465141   1/1  ......................................................................
00460571   1/1  .dalllalgapprlldapelrellp.............................................
00465791   1/1  gvpvellspeelkellplldf.................................................
00490031   1/1  ......................................................................
00458811   1/1  ingvvlergsaedydalipatgaedflgglflpaegilgat.............................
00470291   1/1  kvlGGsssinggvylrgskndfdlwaglaglegwsydellpyfkkaekliiatgsrpllpdlpgglllgg
00529261   1/1  gg....................................................................
00461281   1/1  ylrglpedldelakllgvegwgydellpyfkvaedglgltadaiiiatgsrprypgipg.....plsvsw
00476821   1/1  rgkvlGGsslinggvlvrglpedfdal...glgwsyeellpyfkkaekllgvlgalr.............
00406881   1/1  ......................................................................
00359891   1/1  dalggrvvvigggviglela..................................................
00492221   1/1  ......................................................................
00523131   1/1  ......................................................................
00406021   1/1  ......................................................................
00380741   1/1  ......................................................................
00520321   1/1  .................................................................lglea
00457951   1/1  .................................................................aigle
00475641   1/1  ......................................................................
00396641   1/1  ppavlelegl.gvpflrtsdgald..............................................
00483561   1/1  .......................lvrlalesldalreliatgarplglpipgrdl..gglllard.aldl
00363001   1/1  ......................................................................
00464161   1/1  ......................................................................
00468341   1/1  ......................................................................
00481991   1/1  ldlaellerkdavv........................................................
00486071   1/1  ......................................................................
00529111   1/1  ......................................................................
00477121   1/1  ......................................................................
00364591   1/1  ......................................................................
00471331   1/1  ......................................................................
00440981   1/1  ......................................................................
00526001   1/1  grglavprgrvlggssvingavylradaidfatgargipgwdldgvlpyfdrledslgv.lglpflgkrv
00471411   1/1  ......................................................................
00368891   1/1  ......................................................................
00424461   1/1  ......................................................................
00376431   1/1  ......................................................................
00488071   1/1  ......................................................................
00472701   1/1  ......................................................................
00485831   1/1  ......................................................................
00475651   1/1  ......................................................................
00533211   1/1  ......................................................................
00488661   1/1  ......................................................................
00457971   1/1  ......................................................................
00533221   1/1  ......................................................................
00480091   1/1  ......................................................................
00480451   1/1  ......................................................................
00467601   1/1  ......................................................................
00483651   1/1  ......................................................................
00447051   1/1  ......................................................................
00366541   1/1  ......................................................................
00400491   1/1  ...aleadalllatGarpr.lgipgsdlpgvllalg..........krvvvvgggvigle..........
00384491   1/1  ......................................................................
00461561   1/1  ......................................................................
00472711   1/1  ......................................................................
00509611   1/1  ......................................................................
00482001   1/1  ......................................................................
00496791   1/1  ......................................................................
00384681   1/1  ......................................................................
00501481   1/1  ......................................................................
00509271   1/1  ......................................................................
00467501   1/1  ......................................................................
00455191   1/1  ......................................................................
00479091   1/1  ......................................................................
00469721   1/1  ......................................................................
00470681   1/1  ......................................................................
00485841   1/1  ......................................................................
00503641   1/1  ......................................................................
00363011   1/1  ......................................................................
00480161   1/1  ----------------------------------------------------------------------
00488651   1/1  ......................................................................
00509601   1/2  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00406191   1/1  ..gipedkllkeflareiadl.................................................
00483641   1/1  ......................................................................
00463441   1/1  ......................................................................
00467611   1/1  ......................................................................
00374371   1/1  ......................................................................
00423421   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00457981   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EYTLVFLGGAPHNTPALYSIMSHVDLNGNVFYPEGGIAGVVDALAELAVEQGATIETGVGVNAISGRRGE
00435771   1/1  lga...evtvverrprllalldalalllgllsldalaalepllalellggllypdggpaalvealaeal.
00484941   1/1  lllllll....glspdhligagplrggcdyrgggvfgcpggaglvlggrgslaeallealeelpGveirl
00444131   1/1  ddlslfellerfllldllpklllilgggliglepaelsarlglkvtvlflggllyfgdsaqlyprgGlga
00406601   1/1  vviatGareralpapgldllgrspagalpllsrrflvdllpklllaggglvnlllasdstrylefkalpk
00360921   1/1  ealgl..................dflgkrvvvigggasgvelasalarlgagvtvvyrpdggrgalaral
00458701   1/1  sagyeellrrlgldllgkrvvvigggasavelaalar.agasvtlllrsprlglltprggygalvealak
00491501   1/1  gllllgkrvvviGggaiglelalalarlgaevtlversp...............................
00487711   1/1  l.........daaelraleplldlpdllgglyvpdggvvdpaalaaalaraaealGveirlgtevtgier
00374411   1/1  fdgkgvltardlldllflgkrvvviGggvsglelaealarllkilga.evtllersdrllallddegqvd
00464461   1/1  .......egleadavlla....tGarprllp.....ipgldllggrvvvigggviglelaralaeaaeel
00400351   1/1  elaealarlgapvtlldrsplarlppglls........pgdglldggdgalvaalaealerlgveillgt
00470221   1/1  lgaevtvvlerrdrlllffppd......................................gqvdpaglvr
00529631   1/1  l................................pgwfpvfpgrkelldyladlaeklgveirlnteVtsv
00462701   1/1  ......ealeadallla....tGarprllp.....ipgldllgglvvvigggviglelaralaeaaeelg
00473271   1/1  pklvlvigggviglelaellarlgaevtvlergdgllgggdgqiyprgg....agallealak.gveirl
00413411   1/1  gkrvvviggglsglel..............lvgrgdgaalaralaeaaealgveiltgtevteilrdegg
00462741   1/1  ltadaviiatGarpripdlipglgggvltsddyldledlpgklvdfvllalalaiaviGggasglelasa
00503631   1/1  .........................glpppggggvdraelldylleaaerlgvedvirlgtevtsidfde
00455181   1/1  .....................................aelaaalaeaaeelgveillgtrvt.i..dggv
00499901   1/1  gkrvvvigggasgvdlaellarlgarvtllerldglllpgdgvldpkgglgalleal...leelgveill
00465141   1/1  ....................................gaelaaalaealeelgveillgtrvtei..dggv
00460571   1/1  ...........................................vvvpgggvvdpaallealaeaaeelGv
00465791   1/1  .............................peflgglytprggtvdpaelvralleaaeelGveillgtev
00490031   1/1  ..egleadallla.....tGapprlld....ipgldllggrvvvigggvdglelaralaeaaeelgveil
00458811   1/1  ........................................gsepfllp.gvsllrvldsagalslafrgk
00470291   1/1  dgiltselalsl...........dllpklvvvigggaiglelapvlarlgakvtgvgrlprglpvgdggl
00529261   1/1  ....................................................gfigledargllrlgagv
00461281   1/1  aldldelpkrlvvigggaiglelapflarl.gakvtgvgrlpgll.plggvdpsalvaalakalerlgve
00476821   1/1  .................................kllvvigggaiglglalvldrlgakvtgvgrldrglp
00406881   1/1  .............................plllrvlgaelaaalaealeelgveillgtav..ve.dggr
00359891   1/1  .........................................ralleaaeelpgveillgtevteilgdgd
00492221   1/1  ...................................................llpgggvv..dpaellral
00523131   1/1  ................................ggvdrarlaaalaeaaealgveirlgtevtdllleggr
00406021   1/1  ...adalvlatgarprrlgipglelpggrvvvigg....gvialeeaaeelgveiltgtevtei...dgv
00380741   1/1  ......................................aelaaalaelleelgvevllgtavt.i..ddg
00520321   1/1  dalllatGrpfdlpipglelfgvrglltlldalkleplllssdlaggllypgkrvvvigggaillealae
00457951   1/1  dadelarl.gkrvavlgggel.........lladgvtgglrpdggrvdparlvrallealeelGveillg
00475641   1/1  ...........................................llrllaelaeklgveillgtavtellk
00396641   1/1  ..........................................lk..gglvavigggsiarelalaeaalk
00483561   1/1  dalpkrlavl....gggllgvdelaellpllgsevtgglrsprggtvdparlvralaeaaeelGveillg
00363001   1/1  .....................................eelvlalaelleelgvevrlgtevtsidrdgdg
00464161   1/1  .......................................eelaaalaealeelgveillgtevt.i..ed
00468341   1/1  ..........................lalrllgpdvtggerrpragvvdraellralleaaeelGngrve
00481991   1/1  ......................................................................
00486071   1/1  .....................................greellrylaealeklgveirlgtalfvdpnrV
00529111   1/1  ......................................................gpgggtvdgaalvral
00477121   1/1  .......................................aellralleaaeelgveirlgtrvtsileed
00364591   1/1  ......................................................................
00471331   1/1  ..............................................pellkallealeklgv.illgt..
00440981   1/1  .....................................gaelveallelleelgveillgtevtsidldgg
00526001   1/1  vviGggpigvefaealarlgakvtl.......................................verggl
00471411   1/1  ..................................falpaelldalaelaeklgveirlgtev.......d
00368891   1/1  ...........................................................pelaaallell
00424461   1/1  ..........................................................pipgrvlpkell
00376431   1/1  ................................lrvlgaelaaalaealeelgvevllgtevtsidrdggg
00488071   1/1  ......................................................................
00472701   1/1  ..........................................lrvlgpelaeylrelleklgveillgtr
00485831   1/1  ....................................lllllrrllllllllaagvegllillgvevvvgv
00475651   1/1  ............................................................pelskallel
00533211   1/1  ..............lelaellarlgaevlrlllglltllergdrllpellrallealeelgveirlgt.v
00488661   1/1  ......................................................................
00457971   1/1  ...........................lrvgfiplkrlaelleallelaeklgveillgtevtdidlddd
00533221   1/1  ...........................................................eelslallell
00480091   1/1  ...........................................................eelsllllell
00480451   1/1  ..........................................................pelaaallelle
00467601   1/1  ..................................................................dael
00483651   1/1  .................................................................deela
00447051   1/1  ......................................................................
00366541   1/1  ..............................................................pelskall
00400491   1/1  .........................................laaalaealealpgveillgtevtellgd
00384491   1/1  ........................................................dcilskallellee
00461561   1/1  ..............................giapdfrlpkelldrlielleelgveirlntevgkd....
00472711   1/1  ......................................................................
00509611   1/1  ......................................................................
00482001   1/1  ..........................................................dpelsklllell
00496791   1/1  ................................................................pelley
00384681   1/1  ......................................................................
00501481   1/1  ...........................................llgilgeellarlreqleklgveillg
00509271   1/1  .............................llggvpsglllgaalllallelleklgveillgtevtsidl
00467501   1/1  .....................................llaelllrllelllklgvevllg.evtsidpdg
00455191   1/1  ..........................................................dpelskallell
00479091   1/1  ..................................................pelallllelleklgvevll
00469721   1/1  .....................................pelskallelleklgvelllgtevtaidldgdg
00470681   1/1  .............................llvaagdldaeelvlalaelleelgvevllgtrvtgi..dp
00485841   1/1  ...............................................................pelskll
00503641   1/1  ...........................................................gipypplgk..
00363011   1/1  ..................................................................rpel
00480161   1/1  ----------------------------------------------------------------------
00488651   1/1  ...................................glldaeelaeylrelleklgvevllgtevtsidgd
00509601   1/2  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00406191   1/1  ......................................................................
00483641   1/1  .................................llglldeelalrllelleklgvelllgtevtsidleg
00463441   1/1  ......................................rlgipdpllerleelgveillgvavteilgdg
00467611   1/1  ..........................................................pelsklllelle
00374371   1/1  ....................................................................rr
00423421   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00457981   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00509602   2/2  -kdvvviGgGpaGleaAlalar..glkvtliergdrlggtrpllsgvipgklldeelaeylrelleklgv
00382852   2/2  ---------------------------------------lsklllelleelgvelllgtkvtsiegdgdg


                         -         *         -         -         -         -         +:350
query           FTLATDDGTRTTDLVVNNANPAYAERELLDTGGRDHAPDYWDDQTYAPSALMFYLGVEGDVEPLAHHSLV
00435771   1/1  e.gveillgtrvteierdgggvtvttedadgslkpvledgetieadavvlatGarslarllld.......
00484941   1/1  gteVteiegdgggvtVttedGeeieadlVilatGarsslr..............................
00444131   1/1  laqalaraaeeagvtvllnte-------------------------------------------------
00406601   1/1  slviigggvigvpatraeifsskllslaekrrlmkflgrlleyeelpelvldldlrelaellrrlgldvt
00360921   1/1  araaeaagvtvltgtrvteierdggggrvtgVtledgegltgeevtiradlvvlaaGarsttrllllsg.
00458701   1/1  alendylealarlgveirlgtrvteilrdgggvtvttadGetieadavvlatgarp.laellgllgpelp
00491501   1/1  ..............rlgp.vlpaglsealaealeallGveirlgtrvteierdgggvtvttedGdgeeet
00487711   1/1  dggrvtgVrtadGeieadlvvlAaG.awsn.ellellglelpp...........................
00374411   1/1  ..............................................prglldalaealeellgveirlgt
00464461   1/1  gveillgtrvteilvdeggrvtgvttedadGeeltiradavvlatGgfpnlalllglg............
00400351   1/1  rvteilrdgggvtgVttedgeleldgeevtiradavvlatGarssprllllsg.................
00470221   1/1  alaealeallgveirlgtrvteierdgggvtVttadGetieadlvvlatGarsllrllglpglgleldpa
00529631   1/1  erdgdgvtvttedgep------------------------------------------------------
00462701   1/1  veillgtrvteilvdeggrvtgvtlrdadGeevtiradavvlatGglsnlrlll...glgl.P..i....
00473271   1/1  ntevtri.....e.....dGetieadaVilaaGaipsprllglsgiglk....ldklg.igvvekvrlsv
00413411   1/1  rvtgVvtadtkdGeevtiradavvlatG........................afsnlrlllglglgltgd
00462741   1/1  larlgakvtllersgrllppgglgelvk------------------------------------------
00503631   1/1  dgvvvgvttedGetieadavvlAtGalsrprlppsipgldltfkggvtlsavwsdgalallgllvdllpk
00455181   1/1  vgvttdgetiradavilAtGalslplll..........................................
00499901   1/1  gtpvtei.............Geleadavvlatgldp....laellglelpergl................
00465141   1/1  vgvttedgetieadavvlAtGars..............................................
00460571   1/1  eirlg.rvtsi...........dGetleadlvvlatGags..rellgdlg....................
00465791   1/1  tsierdgdgvtVttedGtiradlvvlAtGa........................wgsp..llkllglp..
00490031   1/1  lgtrvtellvdeggrvtgvvledadGeevtiradavvlatGgfpnlrrllg...................
00458811   1/1  rvvvrltyddnyfndeyqglpereklltlviiGg------------------------------------
00470291   1/1  salvaalakalerlgveiltntrvtrilvdggggglrvtgVetedgggeektiradkeVilaaGaigspr
00529261   1/1  tvvdrgd..............llralaeaaeelGveirlgteVtsierdedgrvtgVttedmeplkdGee
00461281   1/1  iltntrvtrilrdgggkglrvtgvevetadGe--------------------------------------
00476821   1/1  tggrgslakallraaerlGveiltnteVtri---------------------------------------
00406881   1/1  vtl..dgetieadlvvlAtGarsllll...........................................
00359891   1/1  gvtvttgrvtgvvlrdladGeevtiradlvvlatGarsnlllll..........................
00492221   1/1  aealaeelgveirlgtevtdilrdggrvtgvttedllvdkngvevtdgdggtiradavvlAtGarp....
00523131   1/1  vtgVrtadGetlradavvlAtGafsrllll----------------------------------------
00406021   1/1  vgvvledGeeltieadlvvlatGarsnlrlllgldlp.................................
00380741   1/1  rVtl..dgetitadavilAtGarprll...........................................
00520321   1/1  aaeelGveiltgtevteierdggrvtgVtvrdtadGeeetiradlvvlatGarsnvrllgls........
00457951   1/1  .evteierdg........dGe..adlvvlAtGarsplllkl.............................
00475641   1/1  ddggvvvtgdgetira------------------------------------------------------
00396641   1/1  lgveilegtevtellgdgdgkgrvtgvvtkdlktgevgtiradavvlatGgagnlllllsvlepdl..rt
00483561   1/1  tevtsierdggvvgVttedGeiradlvvlAtG.awsp.ellkllgielplgllpvrgqilvv........
00363001   1/1  vtle.dgetleadavvlAtGarprvlll..........................................
00464161   1/1  grvgvtledgeeltleadlvilatGrrslPlllpntellgleklgvelder...................
00468341   1/1  irlgtrvtsierdgelledleeypvtvtlenlseeeakpeelggkvagvllrklledgddgrvtvttedl
00481991   1/1  ..........................dgeelaaalaelleelgvevllgtav..ii.ddgtvtv..dget
00486071   1/1  ts.......vtvtted------------------------------------------------------
00529111   1/1  aeaaleelgveirlgteVtdilvdgggvlwtvrvtGVvvndtgvaldgllkllvdpllllkllldletge
00477121   1/1  gdgvtvtledggeeetieadlvvgAdGarsrvrrllgip...............................
00364591   1/1  gipggvlpeelveala------------------------------------------------------
00471331   1/1  veilgddggvgvtled------------------------------------------------------
00440981   1/1  gv.vltdgetieadavvlAtGarprllglpgldlpggl................................
00526001   1/1  llpgdgvgdraslaralleaaealgveiltgtrvteilrdedggrvtgVetrdladGeeftiradlVvla
00471411   1/1  gvtvttedgetieada------------------------------------------------------
00368891   1/1  eklgvevllgtevtaid-----------------------------------------------------
00424461   1/1  ealaealeklgveillgtev--------------------------------------------------
00376431   1/1  vtgvllvttgdgetir------------------------------------------------------
00488071   1/1  ..ipgkvdpaellealaelaeelgveirlg----------------------------------------
00472701   1/1  vtsidrdgdtgrvtgv------------------------------------------------------
00485831   1/1  adgggvtvvt------------------------------------------------------------
00475651   1/1  leklgvelllgtevtai-----------------------------------------------------
00533211   1/1  tei..dggvvgvtledGeeetleadlvvlatG..svvrlllg............................
00488661   1/1  ...eelaaallelleklgve--------------------------------------------------
00457971   1/1  vvvvltdgetitltad------------------------------------------------------
00533221   1/1  eklgvelllgtrvtaidvdg--------------------------------------------------
00480091   1/1  eklgvelllgtrvtaidvdg--------------------------------------------------
00480451   1/1  klgvelllgtrvtaidldgg--------------------------------------------------
00467601   1/1  aaalaelleklgvevllgt.vteiegddgrvtgvvvvrledgetleadlvilatGglsllll........
00483651   1/1  lallelleklgvelllgte---------------------------------------------------
00447051   1/1  .....dlllelleklgvei---------------------------------------------------
00366541   1/1  elleklgvevllgtevtai---------------------------------------------------
00400491   1/1  ggrvtgvvledgetge------------------------------------------------------
00384491   1/1  lgvevllgtevteveldggg--------------------------------------------------
00461561   1/1  ....vtledllleyda------------------------------------------------------
00472711   1/1  .dlllelleklgveillgte--------------------------------------------------
00509611   1/1  pelskallelleklgv------------------------------------------------------
00482001   1/1  eklgvevllgtevtaiegdg--------------------------------------------------
00496791   1/1  llelleklgveillgtevte--------------------------------------------------
00384681   1/1  ..fpafpelvellkeegvei--------------------------------------------------
00501481   1/1  trvtsidl.dggtvvl------------------------------------------------------
00509271   1/1  dggtvvgvttg-----------------------------------------------------------
00467501   1/1  ..ktvtledgetleyd------------------------------------------------------
00455191   1/1  eklgvevllgtevtei------------------------------------------------------
00479091   1/1  gtrvteiakeylpelllgveveagdgvvtvvlgdgetieadlvilAtGarpnnll---------------
00469721   1/1  vtvvtledgetleadlvllA--------------------------------------------------
00470681   1/1  dgvtvtladgetitad------------------------------------------------------
00485841   1/1  lelleklgvdlllgtkvtaid-------------------------------------------------
00503641   1/1  elldyleeyarklglr------------------------------------------------------
00363011   1/1  skallelleelgvelrlgte--------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00488651   1/1  gkg..vtledgetlea------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00406191   1/1  ................------------------------------------------------------
00483641   1/1  ktvtllllvlgdgetl------------------------------------------------------
00463441   1/1  vel...geeleleaDlvv.latgftpndel................dealrtsvpgvfaiGD--------
00467611   1/1  klgvdvllgtevtaidvddkt-------------------------------------------------
00374371   1/1  pellerleelgakfvlltldeelvevvlal----------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00457981   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00509602   2/2  evllgtevtsidgdgk------------------------------------------------------
00382852   2/2  vvvtledgetleadlvllA---------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LPPDWDGHFAQLFDDPGWPDDPAFYLSVASKTDDTVAPDGHEAVVILLPIAPGLDDTPEIRAQYRDRLLG
00435771   1/1  ....................pplppvrgqalptlplgldtkggllvderlrtsv................
00484941   1/1  .........................lledsglppd...................................
00444131   1/1  ----------------------------------------------------------------------
00406601   1/1  liellerllagldagpl-----------------------------------------------------
00360921   1/1  .....................................lglplppdlgvvgrnp.................
00458701   1/1  ergiiavdglpvgsllkvhlgfdepf.P..........................................
00491501   1/1  ieadavvlatGarpllrlledlglpeplrpalp...........................gleldwrgfi
00487711   1/1  ......................................................................
00374411   1/1  rvteierdgggvtvtledgdgeeetieadlvvlatGars.ltellgl.......................
00464461   1/1  ..........................lpphPdgrllfg......prdd..........de..........
00400351   1/1  ........igpaellkalgielpldlpgvgenlidhptgglla...........................
00470221   1/1  gerlpdgW..............................................................
00529631   1/1  ----------------------------------------------------------------------
00462701   1/1  f.P................dgrlllgprpdde.lrellpglgvalde.......................
00473271   1/1  dgpfaggdladhlqlvpvaide------------------------------------------------
00413411   1/1  glalalrlgaplpdggflqfhPt...............................................
00462741   1/1  ----------------------------------------------------------------------
00503631   1/1  rvvviGgGsglelasalarlgakvtlv-------------------------------------------
00455181   1/1  ......................................................................
00499901   1/1  ......................................................................
00465141   1/1  ......................................................................
00460571   1/1  .......lepvrggfivvdpp................................dpeilrrwvglrpltpd
00465791   1/1  lepvrgqilvleplpe.......vlpvvlaigdgvf.............gglllggtveldgldpdlspe
00490031   1/1  .........ldlpllpvrgtalalgatgdglalleragvelddrgfvqf.....................
00458811   1/1  ----------------------------------------------------------------------
00470291   1/1  llllsgiglklllkalgipvvvdlpvg...........................................
00529261   1/1  kpvpveGetiradlvvlAtGarssprlllleglgle.dgrgyi...........................
00461281   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00406881   1/1  ......................................................................
00359891   1/1  ..............lsgigptgdglalleraglelvde................................
00492221   1/1  ......................rllelpgldlpgvpdalgilvleglplvlpenlq.....gkrvvvigg
00523131   1/1  ----------------------------------------------------------------------
00406021   1/1  ......................................................................
00380741   1/1  ......................................................................
00520321   1/1  ..............................glglpgdgyalairvgeplpdhl.................
00457951   1/1  .pllpvrgqilvleplat.....dlpgvfvigdptg.................gngllvggtaelgg---
00475641   1/1  ----------------------------------------------------------------------
00396641   1/1  tnp-------------------------------------------------------------------
00483561   1/1  ...........dpglfaigdllggillggvtgdggsdlalltevl-------------------------
00363001   1/1  ...................................................................pgl
00464161   1/1  ......................................................................
00468341   1/1  dtgGeeetiradlvvlAtGarsllrkllglelpgggv.................................
00481991   1/1  ieadlvilAtGarprlpplpg.................................................
00486071   1/1  ----------------------------------------------------------------------
00529111   1/1  getirAkavi------------------------------------------------------------
00477121   1/1  ......................................................................
00364591   1/1  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00440981   1/1  ......................................................................
00526001   1/1  aGai........................psprllllsGigl...pevgrilvdhpgggvlilp.......
00471411   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00376431   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00472701   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00533211   1/1  ......................................................................
00488661   1/1  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00467601   1/1  ......................................................................
00483651   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00463441   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00457981   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           TLAAQTGVDLRDRIVVEESACVSEFSEQFGDPGGTALGLAHTLFQTGPLRPGKRDGPDGHYYVGAYTNPG
00435771   1/1  ......................................................................
00484941   1/1  .......................ergaikvlkyrtsvgfdepfwpllll.....................
00444131   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00360921   1/1  ......................................................................
00458701   1/1  ......................................................................
00491501   1/1  pv..derlr.............................................................
00487711   1/1  .................................................pdglpvigpvtgvpglylagg
00374411   1/1  ...pplpprlfpaleglglvp..gggivvddrlrt...................................
00464461   1/1  ..llrllpglgvaliar...........................................ytaggipvdp
00400351   1/1  ...........................................................rmgtpdggivv
00470221   1/1  ......................................................................
00529631   1/1  ----------------------------------------------------------------------
00462701   1/1  ..........................................................hywaggipvdpd
00473271   1/1  ----------------------------------------------------------------------
00413411   1/1  ................................................hytmggivvdpdlrtsvpglya
00462741   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00455181   1/1  .......................glspntpgllleglgielderggivvdenlrtsvpglyaaGdvaggg
00499901   1/1  ...........................................................ivvdpglrtgv
00465141   1/1  ...................lllllgrrpntellglegaglelderggivvdetlrtsvpglyaaGdaagg
00460571   1/1  ..................................................................glpl
00465791   1/1  deeelle---------------------------------------------------------------
00490031   1/1  .fPtll............................................................givv
00458811   1/1  ----------------------------------------------------------------------
00470291   1/1  ......................................................................
00529261   1/1  ......................................................................
00461281   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00406881   1/1  .......................grrpntellllelagleld.rggivvdetlrtsvpgvyaaGdaaggg
00359891   1/1  ...........................................................rggivvdeglr
00492221   1/1  gasglelalylrr---------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00406021   1/1  .................................kelleglgleldtrggivvdetlrtsvpglyaaGdaa
00380741   1/1  ........................glpgitptllleaagvelderggivvdetlrtsvpglyaaGdvagg
00520321   1/1  ......................................................................
00457951   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00363001   1/1  ellegagleldggivvdeylrtsv.................................pgvyaaGdvagvp
00464161   1/1  .............................................................ggilvdetl
00468341   1/1  ......................................................................
00481991   1/1  ......................................................grrpnte.lleaagle
00486071   1/1  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00477121   1/1  ...........................................................prtsvgrvfla
00364591   1/1  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00440981   1/1  ...................................ealglelderggivvdetlrtsvpglyaaGdvagg
00526001   1/1  ......................................................................
00471411   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00376431   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00472701   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00533211   1/1  ....................................vrpnlegllleglglelderggivvdetlrtsvp
00488661   1/1  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00467601   1/1  ..........................................................lgrrpntellgl
00483651   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00463441   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00457981   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           IGMPMCLISGEHVTKAVIDDDPAASGSTDPLAVPGEFNFDTPTTAD------------------------
00435771   1/1  ....................pglyl---------------------------------------------
00484941   1/1  .pglfaaGdaaatggpggve--------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00360921   1/1  .......gtarggivvdpdlrt------------------------------------------------
00458701   1/1  ....................--------------------------------------------------
00491501   1/1  .......................-----------------------------------------------
00487711   1/1  a.....Gvtlapasgrlladlil-----------------------------------------------
00374411   1/1  ....................--------------------------------------------------
00464461   1/1  dgrpllg.rltsvpglyaaG--------------------------------------------------
00400351   1/1  dptlrtlgvpglyaaGdaag--------------------------------------------------
00470221   1/1  ...gggipvdpdlrtgvpgl--------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00462701   1/1  grplrgllrtsvpglyaaGdaas-----------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00413411   1/1  aGdaagpglhganplggnglal------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00455181   1/1  ngvavaiasGrlaaeaiagylk------------------------------------------------
00499901   1/1  pglylaGdaagpggpgvtgaia------------------------------------------------
00465141   1/1  gglvatAiasGrlaaeaia---------------------------------------------------
00460571   1/1  rtpvpglylagdhg..gqgvtl------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00490031   1/1  detlrtsvpglyaaGdaagglhg-----------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00470291   1/1  ......................------------------------------------------------
00529261   1/1  .......................-----------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00406881   1/1  rgaavAiasGrlaaeaiag---------------------------------------------------
00359891   1/1  tsvpglyaaGdaagpglpla--------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00406021   1/1  gpgqgvatalasGrlaaea---------------------------------------------------
00380741   1/1  grlavvAvaeGrlaaenia---------------------------------------------------
00520321   1/1  ...............pggivvd------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00363001   1/1  lpllglggggglaavAllsg--------------------------------------------------
00464161   1/1  rtsvpglyaaGdvagggrla--------------------------------------------------
00468341   1/1  ...................---------------------------------------------------
00481991   1/1  lderggivvdetl.......--------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00477121   1/1  GDaahavhplggqGlnlAi---------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00440981   1/1  pgplavtAlasGrlaalnia--------------------------------------------------
00526001   1/1  ................hwsg--------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00376431   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00472701   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00533211   1/1  gvyaaGdaaggpklavvAlasGrvaa--------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00467601   1/1  eaaglelderggivvdetlr--------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00463441   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00457981   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------