[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for hlac0:ACM56299.1


[Show Plain Result]

## Summary of Sequence Search
   1::368
   9::340  PF01594 0.0% 22.6114649681529  Domain of unknown function DUF20 
   1::368


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDEKRFVIALFGLAVGALVGFIAYRFVAPLTVAVFLYYSTRRLFHRLERFRLPARVRAMSALSLIAVPLI
PF01594         --------ilillllilafiwfistllvpllialvlayllnpvvkfLkkrgvkrslaillvlllllvllv


                         -         -         *         -         -         -         -:140
query           GLLSYTMLLLVIEARRFIEQYPVAETVGAENSWVGDLAELSNPTFDGIMQAYESGQLDPLINFASEQATL
PF01594         lllvllvplliaqltqlvkslp..qyidslqnllnelpesleelellikalesslskvlsnilssilssl


                         +         -         -         -         -         *         -:210
query           LASTLSGLVLSLLITIVVTYYLLLDGSKFHEWLLTFDDDAVVREYLEAVDAELEAVLYGNLLNVIAISII
PF01594         lsllasllklllqlilvllllffflldgeklrqgilsllpkrvrervdailselkktlsgylkgqvival


                         -         -         -         +         -         -         -:280
query           AVVAYTGYNVIAPELVEVPYPALAGALTGVASLIPVIGMKIVYLPLAAVTAVPAALGDEISALVYVAGFL
PF01594         iigvlvfigllllgv........pyalllallvglanlIPyiGaviilipiaiilll...tgg.....ik


                         -         *         -         -         -         -         +:350
query           VLAAIVVDTIPDIVLRPYFSGKTTHVGLLMLAYIFGPVVFGFHGLFLAPIVLVLALTFADTALIRLLGGD
PF01594         allivlivvllvqliednilePklmgkrlklhplvillsliaggslfGlvGlilgpplla----------


                         -         -         -         -         *         -         -:420
query           PEEVGPEVPRGQRQLDEF----------------------------------------------------
PF01594         ----------------------------------------------------------------------