[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for hlac0:ACM56309.1


[Show Plain Result]

## Summary of Sequence Search
   1::357
  47::352  PF00146 0.0% 36.7697594501718  NADH dehydrogenase 
   1::357


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGTAPAQLFPEFLVDTFGLPGVLGEVVASLIGAALVANIILAFSGIAGPWAKRKITAAFTDRIAVNRIGP
PF00146         ----------------------------------------------flvlleRkvlaavqqRkGPnvvgp


                         -         -         *         -         -         -         -:140
query           FGLLIIPAAAVQLLAKELIIPEGVDRPTWDIAPILLPASAMLGFSVIPMGQIGPLNIHLADPEVGLALVF
PF00146         lGllqplaDglKlllKEdvvPaksdkllfllaPvlalvlallawlvlPlee....klvladlnlgvlfll


                         +         -         -         -         -         *         -:210
query           AFASIASVSLVMAGYASNNKYSLLGGLRAVAQNLAYEIPLIVTAMSVVVFAGTLQISGVVGAQTETLVTI
PF00146         alsslavygvllsGwasnskYallgalRaaaqtisYEvslalillsiillsgslnlveiveaqe......


                         -         -         -         +         -         -         -:280
query           AGFDIPAWFAFVNPFAFVLFLTANMAEIGRNPFDIPEAPTEIVGGYQTEYSSAYFVLFYLGEFVHIFLGG
PF00146         .....llwlllaqlplvlvflisalAetnRaPFDlpEaEselvaGynveyssvkfaLfflaeYanlllms


                         -         *         -         -         -         -         +:350
query           AILSVVFLGGASGPGPESISFIWFVVKVWGFFLFTQWARAAIPRVRIDQLIEIGWKGMLVLSFANLVLTA
PF00146         llvsvlflggwlevlllelgiillllklllllflfilvraslPRfRyDqlmklgwkvlLplsLallllva


                         -         -         -         -         *         -         -:420
query           VIVGVIA---------------------------------------------------------------
PF00146         sl--------------------------------------------------------------------