[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for hlac0:ACM57207.1


[Show Plain Result]

## Summary of Sequence Search
   1::349
 141::231  PF01188 0.0% 47.2527472527473  Mandelate racemase / muconate lactonizing enzyme, C 
  11::122  PF02746 0.0% 32.4074074074074  Mandelate racemase / muconate lactonizing enzyme, N 
   1::349


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTLETEFERVSLPLENPFTIFRGTQTDAENVIVKIADEAGMTGVGGAAPSAHYGETADTVEAVLPDLLDA
PF01188         ----------------------------------------------------------------------
PF02746         ----------avklr.PvqlavttvqkqslvlvkietseGvvGigeatsvgg...raetikaelddhlap


                         -         -         *         -         -         -         -:140
query           VERVGDPHALHEIEAELAAVVNGNPAARAAVSIAVHDLAAKRLGVPLHRLWGLDPTAAPATSYTIGLDET
PF01188         ----------------------------------------------------------------------
PF02746         llvgkdaanisdlaqllkravlgnmsAkaaidmAlwDlkakalnlpladLlG------------------


                         +         -         -         -         -         *         -:210
query           ERVREKAEAAVDAGYPILKIKLGTDRDRELIDAVREAAPDARLRVDANEAWTPREAVRKCEWLADRDVEF
PF01188         eelaeeaeeaveegfrafKikvgeedlakDvervaavreavgddvrlrvDanqawtveealrlaraleel
PF02746         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VEQPVPAEDPEGLRFVYERSALPVAADESCVTLSDIPAIADRCDIANLKLMKTGGLLEAKRMIAAARAHG
PF01188         glewiEePlpaedieglaelr-------------------------------------------------
PF02746         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LEVMCGCMIESNASIAAAAQLAPLLDYADLDGSLLLAEDQYDGIEMGGGEIRLGDQERAGTGARPSAEQ-
PF01188         ----------------------------------------------------------------------
PF02746         ----------------------------------------------------------------------