[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for hlac0:ACM57250.1


[Show Plain Result]

## Summary of Sequence Search
   1::293
  13::114  PF01416 0.0% 37.5  tRNA pseudouridine synthase 
 150::248  PF01416 0.0% 27.5510204081633  tRNA pseudouridine synthase 
   1::293


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDASAATRAFRVAYDGREYAGFQRQPHATTVEGTLLRALAKHGILDRGDGPTHATPPGYAAAGRTDAGV
PF01416         ------------elydGthdFsgfqkq...ktvegsleralekigiikeeevvveikgngFlrnqvrimv
PF01416         ------------elydGthdFsgfqkq...ktvegsleralekigiikeeevvveikgngFlrnqvrimv


                         -         -         *         -         -         -         -:140
query           SAVAQTVAFEAPDWLTPRAFNGHLPGSVRVWAAADVPAGFHATHDAVRRTYRYHLYAPARVEETDHDHAV
PF01416         galsrtdkgvhaleqveel..........Lnsklrpkape.rvl--------------------------
PF01416         galsrtdkgvhaleqveel..........Lnsklrpkape.rvl--------------------------


                         +         -         -         -         -         *         -:210
query           DDGRVRDALARLSGEQDFHNLTSDETGTVRDLTTTATREGDILVVEVSAGGFPRALVRRLVAAVRAVGRG
PF01416         ---------elydGthdFsgfqkqktvegsleralekigiikeeevvv.eikgngFlrnqvrimvgalsr
PF01416         ---------elydGthdFsgfqkqktvegsleralekigiikeeevvv.eikgngFlrnqvrimvgalsr


                         -         -         -         +         -         -         -:280
query           TADPSLIDRLLASEPISGEFGIGPAPPEPLVLWDVSYEGVAFEVDPEAAESARVAFGERYRDARHAAAAT
PF01416         tdkgvhaleqveelLnsklrpkapervlkapavgLklf--------------------------------
PF01416         tdkgvhaleqveelLnsklrpkapervlkapavgLklf--------------------------------


                         -         *         -         -         -         -         +:350
query           GAIRDRIAGTDQS---------------------------------------------------------
PF01416         ----------------------------------------------------------------------
PF01416         ----------------------------------------------------------------------