[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for hlac0:ACM55757.1


[Show Plain Result]

## Summary of Sequence Search
   1::729
   5::259  1.3e-69 43.7% 0041170 00411701 1/1   p containing nucleoside triphosphate hy 
  16::260  5.6e-57 42.7% 0052054 00520541 1/1   p containing nucleoside triphosphate hy 
  16::309  5.3e-55 42.6% 0037407 00374071 1/1   p containing nucleoside triphosphate hy 
  20::260  2.1e-52 40.2% 0050449 00504491 1/1   p containing nucleoside triphosphate hy 
 465::623  3.3e-48 43.4% 0041171 00411711 1/1   omal protein S5 domain 2-like           
  19::271  2.2e-47 43.0% 0036239 00362391 1/1   p containing nucleoside triphosphate hy 
  13::278  2.3e-46 39.9% 0037248 00372481 1/1   p containing nucleoside triphosphate hy 
   3::261  4.5e-46 39.7% 0043133 00431331 1/1   p containing nucleoside triphosphate hy 
  18::213  1.9e-43 44.7% 0036958 00369581 1/1   p containing nucleoside triphosphate hy 
  17::189  1.7e-41 41.9% 0050423 00504231 1/1   p containing nucleoside triphosphate hy 
  15::213  1.8e-41 44.3% 0051648 00516481 1/1   p containing nucleoside triphosphate hy 
  14::262  3.6e-41 41.2% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
  15::197  6.6e-41 36.2% 0046936 00469361 1/1   p containing nucleoside triphosphate hy 
  19::213  1.5e-40 40.5% 0039672 00396721 1/1   p containing nucleoside triphosphate hy 
  18::187  4.3e-40 42.0% 0049292 00492921 1/1   p containing nucleoside triphosphate hy 
  17::260    6e-35 42.0% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
 260::385  5.1e-28 40.5% 0048252 00482521 1/1   lation proteins                         
  19::186  4.1e-27 38.7% 0048426 00484261 1/1   p containing nucleoside triphosphate hy 
   3::263  2.9e-26 26.9% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
   4::186    2e-25 30.2% 0049485 00494851 1/1   p containing nucleoside triphosphate hy 
   7::199  4.1e-25 29.8% 0048819 00488191 1/1   p containing nucleoside triphosphate hy 
  22::190  4.8e-25 35.2% 0052691 00526911 1/1   p containing nucleoside triphosphate hy 
  17::153  1.3e-24 38.6% 0046551 00465511 1/1   p containing nucleoside triphosphate hy 
 248::388  2.4e-24 34.5% 0052053 00520531 1/1   lation proteins                         
  19::199    4e-24 31.8% 0051510 00515101 1/1   p containing nucleoside triphosphate hy 
  17::188  3.8e-23 32.2% 0050482 00504821 1/1   p containing nucleoside triphosphate hy 
  11::153  5.5e-23 36.7% 0051448 00514481 1/1   p containing nucleoside triphosphate hy 
  19::189  6.2e-23 34.0% 0051582 00515821 1/1   p containing nucleoside triphosphate hy 
   9::187  6.5e-23 33.3% 0052859 00528591 1/1   p containing nucleoside triphosphate hy 
  17::153  1.1e-22 35.1% 0051927 00519271 1/1   p containing nucleoside triphosphate hy 
  18::153  1.4e-22 35.0% 0044233 00442331 1/1   p containing nucleoside triphosphate hy 
  22::153  1.9e-22 35.4% 0048180 00481801 1/1   p containing nucleoside triphosphate hy 
 388::465  3.2e-22 42.9% 0050452 00504521 1/1   C-terminal domain-like                  
 624::720  6.5e-22 29.9% 0048254 00482541 1/1   C-terminal domain-like                  
   9::186  7.3e-22 32.3% 0037412 00374121 1/1   p containing nucleoside triphosphate hy 
 621::716  2.2e-21 37.6% 0050451 00504511 1/1   C-terminal domain-like                  
 621::709  3.3e-21 40.4% 0052057 00520571 1/1   C-terminal domain-like                  
  19::153  6.3e-21 33.6% 0036153 00361531 1/1   p containing nucleoside triphosphate hy 
  17::153  1.2e-20 29.9% 0035786 00357861 1/1   p containing nucleoside triphosphate hy 
  14::177  2.7e-20 29.7% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
  19::153  4.3e-20 34.5% 0051793 00517931 1/1   p containing nucleoside triphosphate hy 
  22::153  6.8e-20 36.9% 0051156 00511561 1/1   p containing nucleoside triphosphate hy 
 386::464  7.7e-20 42.3% 0048253 00482531 1/1   C-terminal domain-like                  
  19::153  9.3e-20 32.8% 0039999 00399991 1/1   p containing nucleoside triphosphate hy 
  23::189  1.4e-19 30.5% 0052346 00523461 1/1   p containing nucleoside triphosphate hy 
 463::619  1.5e-19 26.1% 0052055 00520551 1/1   omal protein S5 domain 2-like           
 285::389  1.9e-19 32.0% 0050448 00504481 1/1   lation proteins                         
 388::466    2e-19 43.0% 0046824 00468241 1/1   C-terminal domain-like                  
 388::462  2.9e-18 44.0% 0052056 00520561 1/1   C-terminal domain-like                  
  16::153  9.1e-18 28.6% 0044416 00444161 1/1   p containing nucleoside triphosphate hy 
  21::190  1.1e-17 24.8% 0052914 00529141 1/1   p containing nucleoside triphosphate hy 
  20::153  1.6e-17 33.3% 0040239 00402391 1/1   p containing nucleoside triphosphate hy 
  19::188  2.1e-17 26.2% 0035814 00358141 1/1   p containing nucleoside triphosphate hy 
  21::153  3.3e-17 33.6% 0049868 00498681 1/1   p containing nucleoside triphosphate hy 
  15::192  6.4e-17 28.8% 0052724 00527241 1/1   p containing nucleoside triphosphate hy 
  15::181  1.1e-16 24.7% 0050792 00507921 1/1   p containing nucleoside triphosphate hy 
  18::153  1.1e-16 29.9% 0051104 00511041 1/1   p containing nucleoside triphosphate hy 
  19::153  2.2e-16 29.3% 0037045 00370451 1/1   p containing nucleoside triphosphate hy 
  20::169  9.5e-16 31.2% 0051562 00515621 1/1   p containing nucleoside triphosphate hy 
  16::186  9.9e-16 29.3% 0044990 00449901 1/1   p containing nucleoside triphosphate hy 
  22::172  1.2e-15 30.5% 0040747 00407471 1/1   p containing nucleoside triphosphate hy 
  20::174  1.6e-15 28.1% 0051471 00514711 1/1   p containing nucleoside triphosphate hy 
  18::151  2.1e-15 25.2% 0051461 00514611 1/1   p containing nucleoside triphosphate hy 
  17::151  2.4e-15 24.1% 0052002 00520021 1/1   p containing nucleoside triphosphate hy 
 289::381    4e-15 36.0% 0039670 00396701 1/1   lation proteins                         
   3::213  4.7e-15 28.8% 0042471 00424711 1/1   p containing nucleoside triphosphate hy 
  19::202  4.8e-15 25.5% 0047023 00470231 1/1   p containing nucleoside triphosphate hy 
 286::381    5e-15 33.7% 0037246 00372461 1/1   lation proteins                         
   5::176  5.3e-15 29.5% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  17::153  8.4e-15 29.7% 0052502 00525021 1/1   p containing nucleoside triphosphate hy 
  19::153  1.1e-14 28.4% 0053196 00531961 1/1   p containing nucleoside triphosphate hy 
  16::185  1.5e-14 24.3% 0052841 00528411 1/1   p containing nucleoside triphosphate hy 
  17::151  2.2e-14 23.9% 0051460 00514601 1/1   p containing nucleoside triphosphate hy 
  21::172  2.8e-14 27.1% 0036279 00362791 1/1   p containing nucleoside triphosphate hy 
  10::172  2.9e-14 32.1% 0036699 00366991 1/1   p containing nucleoside triphosphate hy 
   6::172  3.2e-14 29.2% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
  18::151  3.4e-14 25.0% 0052735 00527351 1/1   p containing nucleoside triphosphate hy 
  18::174  3.8e-14 23.7% 0051462 00514621 1/1   p containing nucleoside triphosphate hy 
 291::384  4.3e-14 28.9% 0037405 00374051 1/1   lation proteins                         
   6::176  4.5e-14 31.8% 0038732 00387321 1/1   p containing nucleoside triphosphate hy 
  17::151  5.6e-14 27.6% 0045559 00455591 1/1   p containing nucleoside triphosphate hy 
  18::153  6.2e-14 28.2% 0052879 00528791 1/1   p containing nucleoside triphosphate hy 
  20::171  9.5e-14 29.0% 0044740 00447401 1/1   p containing nucleoside triphosphate hy 
  12::187  1.1e-13 28.8% 0041400 00414001 1/1   p containing nucleoside triphosphate hy 
  17::151  1.2e-13 26.1% 0052615 00526151 1/1   p containing nucleoside triphosphate hy 
  18::153  1.3e-13 26.5% 0052625 00526251 1/1   p containing nucleoside triphosphate hy 
  15::153  1.4e-13 28.0% 0051472 00514721 1/1   p containing nucleoside triphosphate hy 
  22::153  1.4e-13 29.2% 0049759 00497591 1/1   p containing nucleoside triphosphate hy 
  19::151  1.9e-13 22.6% 0052680 00526801 1/1   p containing nucleoside triphosphate hy 
  17::176  4.6e-13 29.9% 0044482 00444821 1/1   p containing nucleoside triphosphate hy 
  18::153  4.7e-13 29.9% 0048154 00481541 1/1   p containing nucleoside triphosphate hy 
  19::153  4.7e-13 27.0% 0052832 00528321 1/1   p containing nucleoside triphosphate hy 
  20::191  4.9e-13 27.9% 0051831 00518311 1/1   p containing nucleoside triphosphate hy 
 289::378  5.5e-13 23.9% 0046538 00465381 1/1   lation proteins                         
 466::619  6.8e-13 23.9% 0050450 00504501 1/1   omal protein S5 domain 2-like           
  19::151  7.4e-13 26.3% 0038731 00387311 1/1   p containing nucleoside triphosphate hy 
  19::153    8e-13 28.2% 0051704 00517041 1/1   p containing nucleoside triphosphate hy 
   7::198  8.6e-13 22.0% 0051784 00517841 1/1   p containing nucleoside triphosphate hy 
  17::151  1.1e-12 24.8% 0052528 00525281 1/1   p containing nucleoside triphosphate hy 
  19::151  1.1e-12 21.7% 0051459 00514591 1/1   p containing nucleoside triphosphate hy 
  20::153  1.1e-12 28.7% 0046392 00463921 1/1   p containing nucleoside triphosphate hy 
  15::153  1.8e-12 30.8% 0051832 00518321 1/1   p containing nucleoside triphosphate hy 
 287::381    2e-12 24.7% 0036237 00362371 1/1   lation proteins                         
  16::151  2.2e-12 22.9% 0041234 00412341 1/1   p containing nucleoside triphosphate hy 
  20::151  2.7e-12 28.3% 0037884 00378841 1/1   p containing nucleoside triphosphate hy 
  21::181    3e-12 24.6% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
 288::381  4.5e-12 32.2% 0051646 00516461 1/1   lation proteins                         
  20::170  4.6e-12 27.1% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
  20::153  5.4e-12 26.7% 0051458 00514581 1/1   p containing nucleoside triphosphate hy 
  22::153  1.6e-11 32.8% 0050741 00507411 1/1   p containing nucleoside triphosphate hy 
  15::153  1.7e-11 28.3% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  17::153  2.2e-11 27.4% 0035281 00352811 1/1   p containing nucleoside triphosphate hy 
  18::195  2.6e-11 25.0% 0049269 00492691 1/1   p containing nucleoside triphosphate hy 
  22::189    3e-11 27.4% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  20::185  4.6e-11 23.8% 0051952 00519521 1/1   p containing nucleoside triphosphate hy 
  21::153  5.7e-11 28.1% 0051450 00514501 1/1   p containing nucleoside triphosphate hy 
 288::378  6.9e-11 26.2% 0050420 00504201 1/1   lation proteins                         
  16::151  1.8e-10 25.4% 0052764 00527641 1/1   p containing nucleoside triphosphate hy 
  22::153  1.8e-10 30.4% 0052098 00520981 1/1   p containing nucleoside triphosphate hy 
   9::198  2.9e-10 23.8% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  19::192  4.8e-10 19.9% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
   1::182  5.2e-10 24.4% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  22::191  5.2e-10 26.8% 0048113 00481131 1/1   p containing nucleoside triphosphate hy 
   9::174  8.6e-10 32.2% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  22::153  9.8e-10 31.9% 0052785 00527851 1/1   p containing nucleoside triphosphate hy 
  20::151  9.9e-09 23.9% 0052501 00525011 1/1   p containing nucleoside triphosphate hy 
  19::153    1e-08 28.6% 0049404 00494041 1/1   p containing nucleoside triphosphate hy 
 286::382  3.3e-08 24.7% 0040119 00401191 1/1   lation proteins                         
 290::421  5.1e-08 26.2% 0037975 00379751 1/1   lation proteins                         
  15::156  5.9e-08 27.3% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
 285::381  8.3e-08 23.9% 0049110 00491101 1/1   lation proteins                         
  19::151  1.5e-07 25.6% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  19::177  4.1e-07 24.1% 0049582 00495821 1/1   p containing nucleoside triphosphate hy 
  18::151  4.4e-07 25.2% 0050775 00507751 1/1   p containing nucleoside triphosphate hy 
  15::153  8.5e-07 33.1% 0046711 00467111 1/1   p containing nucleoside triphosphate hy 
  20::153  3.2e-06 25.5% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
 285::379  5.6e-06 22.7% 0045034 00450341 1/1   lation proteins                         
  20::153    1e-05 32.2% 0047547 00475471 1/1   p containing nucleoside triphosphate hy 
 288::382  4.4e-05 20.9% 0049290 00492901 1/1   lation proteins                         
 290::378  5.1e-05 28.1% 0037974 00379741 1/1   lation proteins                         
  21::168  9.5e-05 29.4% 0038794 00387941 1/1   p containing nucleoside triphosphate hy 
  20::153  0.00013 24.5% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
  17::153  0.00016 24.3% 0052005 00520051 1/1   p containing nucleoside triphosphate hy 
   1::729


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGRRKKIVQECERLMDEPDNIRNIAIAAHVDHGKTTLSDNLLAGAGMISQDTAGEQLAMDTKEDEQERGI
00411701   1/1  ----kfslelllalmldlerirniaiiGhvdaGKTTLterLlyytgiiseagevdltvtDtledEreRgi
00520541   1/1  ---------------ldlerirniaiiahvdaGKTtltealllytgaiskagevddgaavlDwmelEreR
00374071   1/1  ---------------lkkkrirniaivGhvdaGKtTLlnaLlgtlgaiseaglvkllkeagelgkgslll
00504491   1/1  -------------------rirniaiighvdaGKTTlteaLllytgaiskagevkdgaavlDwmelEker
00411711   1/1  ----------------------------------------------------------------------
00362391   1/1  ------------------krirnvaivGhvdvGKtTLlnaLlgllgaivgdvallalvldslkeerergi
00372481   1/1  ------------dlslllkrirnvaivGhvdaGKsTLlnaLlgalgaiveagevklalvldsleeererg
00431331   1/1  --ledlldlllllllllllslllkrilniaiiGhvdaGKsTLlnallgltgaiseagavklgkealelgk
00369581   1/1  -----------------kkrirnvaiiGhvdvGKsTLlnaLlgalgaivsdvadlalvldllklerergi
00504231   1/1  ----------------mkkklrnvaivGhvnvGKsTLlnrLlgelglidk.........dvaiverergi
00516481   1/1  --------------lkllelkrirniaiiGhvdaGKsTLlnrLlgetgaidedlllklevlakklgevdd
00517691   1/1  -------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdggtlllllgllsfll
00469361   1/1  --------------M..kkripkiaivGhpnvGKsTLlnrllgakfaigyigtvgndpgttr.ldsleee
00396721   1/1  ------------------krllnvaivGhvdvGKSTLlnrLlgdsgaiveagtvkdgkvlallgkgsfll
00492921   1/1  -----------------ekkirnvaivGhvnaGKtTLlnrLlgek.............ldilseerergi
00401211   1/1  ----------------elkrglnvgivGhvgaGKSTLlnaLl.............gllldtlkgelergi
00482521   1/1  ----------------------------------------------------------------------
00484261   1/1  ------------------kkllkialvGhpnvGKStLlnrl...................tgekv..pgt
00471271   1/1  --prailelesliksllekllellkrlslklkkglkvalvGrpgvGKStLlnallg..............
00494851   1/1  ---ldllglelllslldrllllkkkllkvalvGlpgvGKStLlnall..............gakflakvs
00488191   1/1  ------fllsllrrlslllkrllkvalvGlpgvGKStLlnall..............gakflakvsptpg
00526911   1/1  ---------------------rkvalvGlpnvGKStLlnrllgakvs...................epgt
00465511   1/1  ----------------ekkrllkvalvGlpnvGKStllnallgakfai...............vedepgi
00520531   1/1  ----------------------------------------------------------------------
00515101   1/1  ------------------pleelllslllkkllkvalvGlpnvGKstllnrll.................
00504821   1/1  ----------------eklrllkvalvGlpnvGKStllnallgakfai...............vedepgi
00514481   1/1  ----------alllslllkkllkvalvGlpnvGKstllnrllg...................gkfseygt
00515821   1/1  ------------------glllllllslelkkllkvalvGlpnvGKstLlnrll................
00528591   1/1  --------sallllllelkkllkvalvGlpnvGKstLlnrll...................ggkfseygt
00519271   1/1  ----------------sllsslllkkllkvalvGlpnvGKstllnrll...................ggk
00442331   1/1  -----------------kkkllkivlvGdpgvGKstLlnrllg.................defvedyagt
00481801   1/1  ---------------------akialvGlpnvGKStllnallga...............dfaivedtpgt
00504521   1/1  ----------------------------------------------------------------------
00482541   1/1  ----------------------------------------------------------------------
00374121   1/1  --------gellrlslllkkllkvvlvGlpnvGKstLlnrll...................ggdfdepgp
00504511   1/1  ----------------------------------------------------------------------
00520571   1/1  ----------------------------------------------------------------------
00361531   1/1  ------------------kkllkivlvGdpgvGKstllnrll.................gnefvedypgt
00357861   1/1  ----------------kkdklfkillvGdsgvGKTtLlnrllg................deflveyipti
00409841   1/1  -------------lslelkkglkvalvGrpgvGKSTLlnaLlga...............dlaivsdipgt
00517931   1/1  ------------------kkllkvalvGlpnvGKstllnrllg..................dkvsdepgt
00511561   1/1  ---------------------lkvalvGlpnvGKStllnall...............gadfaiventpgt
00482531   1/1  ----------------------------------------------------------------------
00399991   1/1  ------------------kkelkvvlvGdpgvGKstLlnrll.................ggefvedypgt
00523461   1/1  ----------------------akvalvGlpnvGKStLlnall................gdkaivsdipg
00520551   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00468241   1/1  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00444161   1/1  ---------------ekkdklfkillvGdsgvGKttLlnrllg................defiveyipti
00529141   1/1  --------------------llkvalvGrpnvGKstLl.rl.................lggkfvedypg.
00402391   1/1  -------------------kelkvlllGlpnvGKstllnrll...................ggdfdepgt
00358141   1/1  ------------------kkelkvllvGdsgvGKstLlnrll.................ggefvedyapt
00498681   1/1  --------------------llkvalvGlpnvGKStllnallg................dkfivsnipgi
00527241   1/1  --------------ms.elkllkvvlvGrpnvGKstLlnrllg.................gkfvedypgt
00507921   1/1  --------------sskkkkllkivlvGdsgvGKtsLlnrllg................defiveyipti
00511041   1/1  -----------------ekkllkvvlvGrpnvGKstLlnrl.................lggkfvedypgt
00370451   1/1  ------------------kkllkillvGdpgvGKstLlnrllg................defiveyipti
00515621   1/1  -------------------kelkvlllGlsgvGKTtllnrll..................ggefleeygp
00449901   1/1  ---------------kkkkkllkillvGdsgvGKStLlnrllggk.fivsyip.................
00407471   1/1  ---------------------lkvllvGlpnvGKsTLlnrll...................gdkvdkpgt
00514711   1/1  -------------------kelkvvlvGdpgvGKtsllnrllg................defiveyipti
00514611   1/1  -----------------lkkllkvvlvGdpgvGKttLlnrllg................gefiveyipti
00520021   1/1  ----------------lkkkllkivvvGdsgvGKttLlnrllg................gkfieeyipti
00396701   1/1  ----------------------------------------------------------------------
00424711   1/1  --hskkaldelelvldnadvilevvdardpllsldvrlaellegkprllvlnKaDlldaealallleals
00470231   1/1  ------------------elaellsllierlllrdlllelkllkvllvGdpnvGKStLlnrl........
00372461   1/1  ----------------------------------------------------------------------
00410321   1/1  ----yggllllkdlslelkkglkilllGlngaGKTTllnrll..................ggefp.eygp
00525021   1/1  ----------------eldkllkvvlvGdpnvGKssLlnrll.................gdvfvsdypgt
00531961   1/1  ------------------kkllkvvlvGdpnvGKstLlnrl.................lggkfvsdypgt
00528411   1/1  ---------------sllkkllkvvlvGrpnvGKstLlnrll.................ggkfaivsyip
00514601   1/1  ----------------lkkkllkivlvGdsgvGKTsLlnrllg................gefiveyipti
00362791   1/1  --------------------elkilvvGdsgvGKttLlnrllg................gefiveyipti
00366991   1/1  ---------esllkklelkkllkillvGlpgvGKTtllnrll...................ggefeeyvp
00378621   1/1  -----glklllrrlslllkkglkvllvGlpgvGKstllnrla...................geefdtpgt
00527351   1/1  -----------------kdkllkivlvGdsgvGKttllnrllg................gefiveyipti
00514621   1/1  -----------------lkkllkvvlvGdsgvGKtsLlnrllg................gefiveyipti
00374051   1/1  ----------------------------------------------------------------------
00387321   1/1  -----glkglllrlklelkkllkillvGlpgvGKTtllnrllg...................defveygp
00455591   1/1  ----------------kkdkllkilvvGdsgvGKttllnrllg................gefiveyipti
00528791   1/1  -----------------kkkllkvvlvGdpnvGKstLlnrllg.................gkfvsdypgt
00447401   1/1  -------------------kelkivlvGdsgvGKttLlnrllg................nkfivsyipti
00414001   1/1  -----------rrlllelkmllrvgivGlpNvGKSTLfnaLt.gakvaivanyp...............f
00526151   1/1  ----------------elkkllkvvllGdsgvGKTtllnrllg................gkfieeyipti
00526251   1/1  -----------------kdkllkvvlvGdpgvGKstLlnrllg................gefiveyipti
00514721   1/1  --------------lskke..lkvvlvGdpnvGKssLlnrl.................lggkfvsdypgt
00497591   1/1  ---------------------lkvvlvGrsgvGKStLlnallgekvakvsdi........satlgrgpgt
00526801   1/1  ------------------kkelkvvllGdsgvGKtsLlnrllg................gefiveyipti
00444821   1/1  ----------------elkkllkvllvGlpgvGKttllnrll...................ggefaiygp
00481541   1/1  -----------------glkkllkvvlvGdpnvGKstLlnrllg..gvfvsdypgttgdfivktve....
00528321   1/1  ------------------dkllkvvlvGdpnvGKssLlnrll................ggkfivsyipti
00518311   1/1  -------------------gelkvvlvGdpnvGKssLlnrll.................ggkfvedypgt
00465381   1/1  ----------------------------------------------------------------------
00504501   1/1  ----------------------------------------------------------------------
00387311   1/1  ------------------kkllkillvGdsgvGKtsLlnrllg................gefiveyipti
00517041   1/1  ------------------kkllkvvlvGdpnvGKstLlnrl................lgdkfivsyipti
00517841   1/1  ------hgegirdlldlidelrdllerldldlpkiavvGrpnvGKSsLlnallgrdflpvssgpgTtrpt
00525281   1/1  ----------------kkdkllkvvlvGdsgvGKTsLlnrllg................gefiveyipti
00514591   1/1  ------------------kkllkvvllGdsgvGKTsLlnrllg................gefiveyipti
00463921   1/1  -------------------lkllkvvlvGdpnvGKssLlnrll.................ggkfvsdypg
00518321   1/1  --------------msslelkkllkvvlvGdpnvGKstLlnrll.................ggkfvsdyp
00362371   1/1  ----------------------------------------------------------------------
00412341   1/1  ---------------lkkkkllkillvGdsgvGKtsLlnrllg................gefiveyipti
00378841   1/1  -------------------kelkillvGdsgvGKstLlnrllg................defiveyipti
00405881   1/1  --------------------gervglvGrpgaGKSTLlnaltglk.aivsgypgttldpnlgvveldd..
00516461   1/1  ----------------------------------------------------------------------
00403151   1/1  -------------------kglkivlvGdsgvGKTtLlnrllg..................defpvsyip
00514581   1/1  -------------------kelkvvlvGrpnvGKssLlnrllg..................gkfivsyip
00507411   1/1  ---------------------lkvalvGlPNvGKSTLf.naltgakaivanyp...............ft
00432181   1/1  --------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlgv.......
00352811   1/1  ----------------lekkelkilllGlgnvGKsTllnrllgge...................f.ergp
00492691   1/1  -----------------GlkkllkvvlvGdpnvGKStLlnrl.................lggkfvsdypg
00513761   1/1  ---------------------kiiaivGkgGsGKTTllnklaglladggkvlvidlDparanlpeqlgid
00519521   1/1  -------------------kelkilllGlpnvGKstllnrllgeefdkp...................gp
00514501   1/1  --------------------lk.vvlvGrpnvGKstLlnrllg................gkfivsyipti
00504201   1/1  ----------------------------------------------------------------------
00527641   1/1  ---------------lkkkkllkivllGdsgvGKTsllnrllg..................gefveeyip
00520981   1/1  ---------------------glkvvlvGdpnvGKstLlnrllg..gvfvsdy...............pg
00477011   1/1  --------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnall.Gldvlpvgggpgtrrp
00414121   1/1  ------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilidgqlledl
00356411   1/1  lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgle......................
00481131   1/1  ---------------------lelkvvlvGdpnvGKssLlnrllg.................gkfvsdyp
00410531   1/1  --------gelknlslelkkglkillvGlngvGKTtllkrlag...................gefvdygp
00527851   1/1  ---------------------lelkvvlvGdpnvGKstLlnrllg..gkfvsdy...............p
00525011   1/1  -------------------kelkvvlvGdpgvGKssLlnrll.................ggefvedylpt
00494041   1/1  ------------------kkeikilllGlgnvGKttllnrllggefdep...................gp
00401191   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00440861   1/1  --------------MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsl
00491101   1/1  ----------------------------------------------------------------------
00490731   1/1  ------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrpaa
00495821   1/1  ------------------akelkvlllGlsnvGKttllnrl.....................kfvety.p
00507751   1/1  -----------------dlkllkvvlvGdpnvGKssLlnrllggk.fvs................dyppt
00467111   1/1  --------------lgepiqlidedgglldlldelleilseidqpvlvvaivGrpnvGKStLlNaLl...
00515511   1/1  -------------------kgekvlllGlsgsGKSTllnrllg....................leflpgp
00450341   1/1  ----------------------------------------------------------------------
00475471   1/1  -------------------mglkvalvGlPNVGKSTLl.NaLtgakaivanypgt...............
00492901   1/1  ----------------------------------------------------------------------
00379741   1/1  ----------------------------------------------------------------------
00387941   1/1  --------------------mkviavtsgkgGvGKTtlaanLaaalaerGkkVllidaDpqgpslslllg
00515531   1/1  -------------------kgekvallGlsgsGKSTllnrllglefa....................ygp
00520051   1/1  ----------------psrkelklvvvGdsgvGKTsLlnrllg................gkf.ekyvptv


                         -         -         *         -         -         -         -:140
query           TIDAANVSMTHEYEDTNHLINLIDTPGHVDFGGDVTRAMRAVDGALVVVDAVEGAMPQTETVLRQALREG
00411701   1/1  TikssatslewelieelllelkldidgkgylinliDTPGhvdFsseveralrvaDgailVvDavegvepq
00520541   1/1  gitikssavsley....kgylinliDTPGhvdFseeveralrvlDgAvlvvdaveGvevqTetllrqalk
00374071   1/1  aavldsleeerergitidiaavsfet....dgrkitliDtPGhvdfikevirglsvadgallvvdavege
00504491   1/1  gitikssavslew....kgylinliDTPGhvdFseeveralrvlDgavlvvdaveGvepqtetllrlark
00411711   1/1  ----------------------------------------------------------------------
00362391   1/1  Tidigavtletd....grlitliDtPGhvdfvkevlrglrvadgailVvdavegvmpqtrehlllarllg
00372481   1/1  itidsgavsletd....grkinliDtPGhedfskevlrglavadgallVvdaadgvspqteevlllarll
00431331   1/1  gslllalvldsldeErergiTidiaavsfet....dgrkitliDtPGhedfikevirglsvadgallVvd
00369581   1/1  tidiglvsleld....glkitliDtPGhedflkevlrglavadgallVvdategvlpqtrevlllakllg
00504231   1/1  Tidialvil....elkgrklnliDtPGhedfsslvlralrvadgallvvdatdgvtpqtlevlllllllg
00516481   1/1  glllaivldklelerergitidsaavsfetd....grkinliDtPGhedfvkevlrglrvadgallVvda
00517691   1/1  alvldslplerergitidvalarllldg....rkilllDtPGhedfvkevlralrladgallvvdadegv
00469361   1/1  rergitidsglvkfelng......lnliDtPGhedfrsltlrylrgadgallVvdatdgvsfqtlellel
00396721   1/1  llvldsldeerergitidiaavsfetk....grkltliDtPGhedfrkevirglrvadgailVvdasdge
00492921   1/1  tidsaattleldgrdlllllllgklllllllslellkqlnliDtPGhedfssevlralrvadgallVvda
00401211   1/1  tikigaasllldklaivsdtpgttldpilgvleldgpkllllDtPGhedflkellralaladgallvvda
00482521   1/1  ----------------------------------------------------------------------
00484261   1/1  tgaidii.gtveldg....vklnliDtpGqedfrslverylrgfleeadgvllVvdatedregfeeqtke
00471271   1/1  .gdfaevgptpgtTrdikvvtv....egkgvkltliDtpGlgdpaslqeefralvlrylrlrgadavllV
00494851   1/1  ptpgttidiklgvl.......gvkltliDtpGlgdldviielaerlrdlvreylralrgadgvllvvdat
00488191   1/1  ttrdik....tveldg...kltliDtPGlgdllviielaslledfrsltlrylrgadvvllvvdatdgll
00526911   1/1  Tiginfgtvelk.dgklvkltliDtpGqedfraellrsylrgadgillVvdatdpesgfeeltkellell
00465511   1/1  tidinlg.veldgk...vkltliDtpGlidgapellqedfralvlrylrgadgvllvvdatd.lleqlle
00520531   1/1  ----------------------------------------------------------------------
00515101   1/1  ggkfvereptitidi....gtveldg..vkltlvDtpGqedfrrltlrylrgadgvllvvdatdresfeg
00504821   1/1  tidinlgtveld....gkklvliDtpGlidgaselqedfrkltlrylrgadvvllvvdatdglfeqtlel
00514481   1/1  Tidinf..gtveldg..vklvlvDtpGqedfrrltlrylrgadgvllvvdatdresfegveeqleellel
00515821   1/1  ...gakfvsrgpTiginl..gtveldg..vkltlvDtpGqedfrslvlrylrgadgvllVvdatdresfe
00528591   1/1  Tiginf..gtveldg..vkltlvDtpGqedfrslrlrylrgadgvllVvdatdresfegvekqleellel
00519271   1/1  fseygtTiginf..gtveldg..vklvlvDtpGqedfraltlrylrgadgvllvvdatdresfegveeql
00442331   1/1  tgdni..vktveldgkkvklnlwDtpGqedfrslvelylrgadgvllVvdatdresfegvkkwleeilrl
00481801   1/1  tidinlgvveld....gvkltliDtpGlidgaseglqedfrslllrylrgadvvllvvdatdglleqdle
00504521   1/1  ----------------------------------------------------------------------
00482541   1/1  ----------------------------------------------------------------------
00374121   1/1  Tiginf..gtveldg..vkltliDtpGqeefrsltlrylrgadgvllVvdasdgdsfeevlelleellel
00504511   1/1  ----------------------------------------------------------------------
00520571   1/1  ----------------------------------------------------------------------
00361531   1/1  tgdli..vktveldgkkvklnliDtpGqeefrslrerylrgadgvllVvdatdgesfeelkewleeilel
00357861   1/1  gidfytktvei..dgkkvklqiwDtaGqerfrslrslyyrgadgvllvyditdgesfeelkkwleellrl
00409841   1/1  trdpilgvvlldgr....dllllDtPGlidfaseptnlldleiieallraleeadvvllvvdadrglleq
00517931   1/1  Tidinf..gtveldg..vkltlvDtpGqerfrslrllylrgadgvllvvdatdrdsfeglkeqllellel
00511561   1/1  tidiklvvvelk....gvklvliDtpGlidgalelqerflslrvlrylrgadvvllvvdatdglfeqlee
00482531   1/1  ----------------------------------------------------------------------
00399991   1/1  tg..dflvktveldgktvkltlwDtpGqeefrslrerylrgadgvllVvdatdresfeglkkwleeilel
00523461   1/1  itrdiqtgtle........kltliDtpGllltkllegalldllerflrslllsylrgadvvllvvdatdl
00520551   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00468241   1/1  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00444161   1/1  gvdfytktvev..dgktvklqlwDtaGqerfrslrelyyrgadgvllVydvtdresfenlkkwleeilrl
00529141   1/1  tig.dfivgtveldgklvklqlwDtpGqerfrslrllylrgadvvllvvdatdgesfenlkkwllellel
00402391   1/1  Tigvnv..gtveldg..vklqlwDtpGqerfrsltllylrgadgvllVvdasdgdsfeellkwleellel
00358141   1/1  tgddi..tktveldgkkvkltlwDtaGqerfrslrelylrgadgvllVvdvtdgesfeelkkwleeilnl
00498681   1/1  tidpnvgtvel..dgk.vkltliDtpGlidpaslqedfrslllrylrgadvillvvdatd.lsfedlekl
00527241   1/1  tg..dfllktveldgklvklqlwDtpGqerfrslrllylrgadgvllVvdatdpesfeglkkwllellel
00507921   1/1  gvdfltktiev..dgkkvklqlwDtaGqerfrslrelylrgadgvllVydvtdresfedlkkwleellel
00511041   1/1  tg..dfllktveldgkkvklqlwDtpGqerfrslrllylrgadgvllvvdatdpesfeglkkwllellel
00370451   1/1  tvdfltktvel..dgklvklqlwDtaGqerfrslrelylrgadgvllvvdatdresfedlkkwleeilel
00515621   1/1  Tigvnf..vtvdlkd..vklqlwDtaGqerfrslwelyyrgadgvilVvdatdrdsfeevkkwleellel
00449901   1/1  titvdiltktveldgkkvkltlwDtpGqeefrslrelyyrgadavllvvdatdpesfenlkkwleellel
00407471   1/1  Tiginl..gtveldg..vkltlvDtpGqerfrslwlrylegadavilvvdasdpdsfeelkelleellel
00514711   1/1  gvdfltktvev..dgktvklqlwDtaGqerfrsltelyyrgadgvllVvdvtdresfenlkkwleellel
00514611   1/1  gvdfltktvev..dgkkvklqlwDtaGqerfrslrelyyrgadgvllvvdvtdresfedlkkwleellel
00520021   1/1  gidfytktvev..dgkkvklqiwDtaGqerfrslrelyyrgadgvilvydvtdresfenlkkwleeilel
00396701   1/1  ----------------------------------------------------------------------
00424711   1/1  lglgnvafksalgglglealldlllellkellellrlslllkkglkvalvGlpnvGKSTLlnaLlgakva
00470231   1/1  ............kivsd.pgtTigv...vgtveldg..vklqlwDtaGqerfrsltlrylrgadavllVv
00372461   1/1  ----------------------------------------------------------------------
00410321   1/1  tiginv..gtveldg..vklqlwDtaGqerfrsllllylrgadgvllVvdatdgdsfeevkellleilel
00525021   1/1  tg..dflvktveldgklvklqlwDtpGqerfrslrllylrgadgvllVvdatdgesfedlkkwleellel
00531961   1/1  tg..dfivktveldgktvklqlwDtpGqerfrslrllylrgadvvllVvdatdgesfedlleelleelre
00528411   1/1  titldfllgtveldgkkvklvlwDtpGqerfrslrllylrgadvvllVvdatdgesfedlkkwleellel
00514601   1/1  gvdfytktvev..dgkkvklqlwDtaGqerfrslrelyyrgadgvllvydvtdresfenlkkwleellel
00362791   1/1  gvdfytktvev..dgkkvkltlwDtaGqerfrslrelyyrgadgvllvydvtdresfedlkkwleellkl
00366991   1/1  tiginf..vtveikg..vklqlwDtaGqerfrslwllylrgadgillVvdatdgdsfeevakwleellnl
00378621   1/1  tiginf..gtveldg..vklqlwDtpGqerfrsltlrylenadvvllvvdasdpdsfeellelleellel
00527351   1/1  gvdfltktiel..dgkkvklqlwDtaGqerfrslrelyyrgadgiilVydvtdresfenlkkwleellel
00514621   1/1  gvdfytktvev..dgkkvklqlwDtaGqerfrslrelyyrgadgvilVydvtdresfedlkkwleellel
00374051   1/1  ----------------------------------------------------------------------
00387321   1/1  tiginf..vtvdlkg..vklqlwDtaGqerfrslwllyyrgadgillVvdatdgdsfeevaklleeilel
00455591   1/1  gidfytktvev..dgkkvklqlwDtaGqerfrslrelyyrgadgillvydvtdresfeelkkwleeilrl
00528791   1/1  tr..dfnlktveldgklvklqlwDtpGqerfrslrllylrgadvvllVvdatdresfedlkewleellel
00447401   1/1  tvdiltkevei..dgkrvklllwDtpGqeefrsllelylrgadgvllVvdatdpesfenlkkwleellel
00414001   1/1  tTldpnlgvvelpderldllaglakpkklvgapvvlvDtpGliegaslgeglgrqflaaleeadvilhVv
00526151   1/1  gvdfgtvtleledlylklvlvdgknvklqlwDtaGqerfrslrplyyrgadgvilVydvtdresfenlkk
00526251   1/1  tvdflvktvel..dgktvklqlwDtaGqerfrslrelylrgadgvllvvdvtdpesfedlkkwleellel
00514721   1/1  tgdni..lktveldgklvklqlwDtpGqerfrslrllylrgadvvllVvdatdgesfeeldewllellre
00497591   1/1  trdiilikldrg.......llliDtPGirefglldeeaveltllylegadllllvvdathg.fepdcavl
00526801   1/1  gvdfytktvev..dgkkvklqlwDtaGqerfrslrelyyrgadgvilVydvtdresfenlkkwleellel
00444821   1/1  tiginf..gtveldg..vklqlwDtaGqerfrslwllylrgadavllVvdatdgdsfeelkellleilel
00481541   1/1  .............ldgklvklqlwDtpGqerfrslrllylrgadvvllvvdatdgesfeeldeellellr
00528321   1/1  ltldfivktvel..dgkkvtllllqiwDtpGqerf..ltllylrgadvvllvvdatdgesfedlkkwlee
00518311   1/1  tgdtil..ktveldgklvklqlwDtpGqerfr.ltllylrgadvvllvvdatdresfeglkkwllellel
00465381   1/1  ----------------------------------------------------------------------
00504501   1/1  ----------------------------------------------------------------------
00387311   1/1  gvdfltktvev..dgkkvklqlwDtaGqerfrslrelyyrgadgvllvydvtdresfedlkkwleeilrl
00517041   1/1  trdfllktvel..dgklvklqlwDtpGqerfrsllelylrgadvvllvvdatdgesfedlekwleellel
00517841   1/1  elrlgespellaeflidggekltdldelrkeieeatdallgpgkgfsfdtieleielpdlpnltlvDtPG
00525281   1/1  gvdfytktvev..dgkkvklqlwDtaGqerfrslrelyyrgadgvllVvdvtdresfenlkkwleellel
00514591   1/1  gvdfytktiev..dgkkvklqiwDtaGqerfrslrelyyrgadgvilVydvtdresfenlkkwleellel
00463921   1/1  ttr..dfivktveldgklvklqlwDtpGqerfrslrllylrgadvvllvvdatdresfeeldeellellr
00518321   1/1  gttvdf..nvktveldgkkvklqlwDtpGqerfrslrllylrgadvvllVvdatdresfeevdeellell
00362371   1/1  ----------------------------------------------------------------------
00412341   1/1  gvdfltktvev..dgkkvklqlwDtaGqerfrslrelyyrgadgiilvydvtdresfenlkkwleeilrl
00378841   1/1  gvdvytktvei..dgkkvklqlwDtaGqerfrsllelyyrgadgillvvdvtdresfeelkkwleeilrl
00405881   1/1  ................grqlvlvDtpGlielaslgeglvrqalealeradvillvvdasdplldqpvell
00516461   1/1  ----------------------------------------------------------------------
00403151   1/1  tigvdfyvktveidgkklvkltlwDtaGqerfrslrelyyrgadgvllvydvtdresfenvlswleelre
00514581   1/1  titrdfilktveldgkkvklqlwDtaGqerfrdslrelylrgadvvllvvdatdgesfedlkkwleelle
00507411   1/1  TrdpnlgvvevdderldllaelslkpalgvkpkkivpakivlvDtpGlikgaslgeglgnqflaairead
00432181   1/1  ............veldgrklvliDtpGleefasggekqrvalalallreadvlllvvdadeptsfldlel
00352811   1/1  Tiginv..etfeidg..vkftiwDtgGqrdfrklwilyfegadaiifVvdssdydsflnvdkwtnrleea
00492691   1/1  ttrdfnvktvel..dgklvkltlwDtpGqerfrslrklyyrgaleailllllglllleleeadvvllVvd
00513761   1/1  irdlidletvmelglgpngalvfaleellttld...................illealelleedydyili
00519521   1/1  Trgvnvgtvei....ggvkfrlwDtgGqrrfrklwllyfedadaiifvvDasdydqvlledelrnrleel
00514501   1/1  tldfllktvel..dgkevklqlwDtpGqerfrsllelylrgadvvllvvdatdgesfedlkkwleellel
00504201   1/1  ----------------------------------------------------------------------
00527641   1/1  tigvdfytktievdgknvklqlwDtaGqerfrslrplyyrgadgiilVydvtdresfenlkkwleellel
00520981   1/1  ttg..dfivktveldgkkvklqlwDtpGqerfrslrllylrgadvvllvvdatdresfeevdewllellr
00477011   1/1  telrlsetpgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisrdairleielpglp
00414121   1/1  gvlavrlgigyvpqtlglfpaltvlellalalllredpdlilidsgGqkqrlalaralladpdlgellll
00356411   1/1  ygpTiginegtieidg....vkltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrl
00481131   1/1  gtt..rdfivktveldgklvklqlwDtaGqerfrsllelylrgadvvllVvdatdresfeeldeelleel
00410531   1/1  tigvnf..ktvevdg..vklviwDtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellgl
00527851   1/1  gttgdni..lktveldgklvklqlwDtpGqerfrslrllylrgadvvllvvdatdresfeeldewllell
00525011   1/1  tgddf..tktvevdgktvklqiwDtaGqerfrsltelyyrgadgvllvydvtdresfedlkkwleellel
00494041   1/1  Tigvnvttftl....kgvklqlwDtgGqerfrslwelyfegadaiifvvdlsdgdsflnldkwlnrlees
00401191   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00440861   1/1  lnvalvGpsGsGKStLlnaLl..................gllkpdegvilvggkgvTrdivlytle.dgv
00491101   1/1  ----------------------------------------------------------------------
00490731   1/1  dellgvlaeelgldvl..lgarggdlsgglrqrlarallgdydvliiDtpgtldvllelallellkella
00495821   1/1  Tigvnf..ktveidg..vklqiwDtaGqerfrslwllyyrgadaiifVvDlsdrdqvlledelvnsfeev
00507751   1/1  tg..dfivktveidgklvklqlwDtaGqerfrslrllylrgadvvllvvdvtdresfedlkkwleeilel
00467111   1/1  ........gekvgfaivs....gvpgtTrdiwmwivvl.ieldgrpllliDTpGlgdtekedekelvkia
00515511   1/1  Tigptegtieidg....vklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqs
00450341   1/1  ----------------------------------------------------------------------
00475471   1/1  TrdpnlgvvelpdgrldllaelvkpkkivpapivlvDtpGliegasegeglgnqflaaireadvilhvvd
00492901   1/1  ----------------------------------------------------------------------
00379741   1/1  ----------------------------------------------------------------------
00387941   1/1  legeplgladllageadledailetpegldllpaglllaglellrgerlrelleeladdyD.....vvii
00515531   1/1  Tigptsgtieidg....vklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqd
00520051   1/1  gvdyl...ktvevdgklvrlqlwDtpGqerfr.....yyrgadgvllvfdlsdpesfenlkkwlkellel


                         +         -         -         -         -         *         -:210
query           VKPALFINKVDRLISELQEGPQEMQERLMSVIADVNELIRGMAENMDDIPEDWTVSVEDGTVGFGSALYK
00411701   1/1  teevlrqarkegipiilviNKiDrlgadlllvleelyeklsrlieevnviis...glnddllgkllvspl
00520541   1/1  ygipiivfiNKlDrlgadllelleeieerl.......................gllvvplqlpigfgsgf
00374071   1/1  feaglsvepqtrevlllalllgvphiivviNKiDl........vdadeerlleileellellkklgylpi
00504491   1/1  ygvpiivfiNKmDrpg.dflelleeirellglll.................plqlpigsgsdfvgvvdll
00411711   1/1  ----------------------------------------------------------------------
00362391   1/1  vpkiivviNKiDlvdaderlelvveellellkklglllel......................vpvvpvSa
00372481   1/1  gvpkiivvlNKiDll....................dadelleevkeelrellkllgllledvpvvpiSal
00431331   1/1  asegvlerllelepqtrevlllalllgvphiivviNKiDll......dadpleelleeikeelgllllkl
00369581   1/1  vpniivvlNKiDlvdaeerleevleelrellkllgll......................gelvpvvpiSa
00504231   1/1  vpiivvlNKiDlvdadrleevleeleellkllllpldvpivpisaltge---------------------
00516481   1/1  tegvepqtrevlllarllgvpriivvvNKiDl........vgadeerleevleeieellkllglvpld..
00517691   1/1  slpqtrevlllllllgvpniivvlNKiDlvdaeeleevleelrellkllglpl.................
00469361   1/1  llelgvpiilvlNKiDlvdadeleeleellkklglplelvpllldllldsllldlll-------------
00396721   1/1  sfagievepqtrellllarllgvphiivviNKiDlldadeleevleeieeelgellaklgfplgd.....
00492921   1/1  tdgvslpqteevlelllelgvpniivvlNKiDlvdadrleevleele-----------------------
00401211   1/1  degeflpqtlevlllllelgvkpiilvlNKiDlvdaelleevleeleellkllglln.............
00482521   1/1  ----------------------------------------------------------------------
00484261   1/1  llellrllglllllgvpiilvlNKiDlldareveevleelkeelka------------------------
00471271   1/1  vdatdpglfeqdlellkellelfgelagvpiilvlNKiDlldaee........veleeeiaellalllkl
00494851   1/1  dglfeqdlellklllelgvpiilvlNKiDlldeaelevlleelrel------------------------
00488191   1/1  eqtlelleellelgvpiilvlNKiDlldaeeleevveeleelllalglgip.vvevsak-----------
00526911   1/1  relgllagvpliilvlNKiDlldareveelleelreelkklakelgllle--------------------
00465511   1/1  lleellelgvpii---------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00515101   1/1  veeqleellellrllgvpiilvlNKiDlldaeelrevseelaellakllgi.pvvetsa-----------
00504821   1/1  lellrellpgvpiilvlNKiD.llddrevlleelrellglvpvvevsa----------------------
00514481   1/1  llllgvpiilvln---------------------------------------------------------
00515821   1/1  gveeqleellellkllgvpiilvlNKiDlldaeelrevleelaellake---------------------
00528591   1/1  lrllgvpiilvlNKiDlleareveellaelellllllllgllllela-----------------------
00519271   1/1  eellelllllgip---------------------------------------------------------
00442331   1/1  lplanvpiilvgn---------------------------------------------------------
00481801   1/1  llellrelgvpii---------------------------------------------------------
00504521   1/1  ----------------------------------------------------------------------
00482541   1/1  ----------------------------------------------------------------------
00374121   1/1  lllanvpiilvlNKiDlldareleellellellllllvsteealel------------------------
00504511   1/1  ----------------------------------------------------------------------
00520571   1/1  ----------------------------------------------------------------------
00361531   1/1  lpladvpiilvgN---------------------------------------------------------
00357861   1/1  ap..nvpiilvgn---------------------------------------------------------
00409841   1/1  dlellelllelgkpvilvlNKiDlldaeellleevle---------------------------------
00517931   1/1  llllgvpiilvlN---------------------------------------------------------
00511561   1/1  llellr..gvpii---------------------------------------------------------
00482531   1/1  ----------------------------------------------------------------------
00399991   1/1  lllagvpiilvgN---------------------------------------------------------
00523461   1/1  esfesvllllglkeqllellkllellgvpiilvlnKiDll.adaeevee---------------------
00520551   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00468241   1/1  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00444161   1/1  lp.sgvpiilvgN---------------------------------------------------------
00529141   1/1  lelagipiilvgnKiD.llearevsleellelakelglpvievSaktgeg--------------------
00402391   1/1  llllgipiilvlN---------------------------------------------------------
00358141   1/1  lpladvpiilvgnKiDllee..revseeeglelakelglipfvetSak----------------------
00498681   1/1  leelrellpellg---------------------------------------------------------
00527241   1/1  lelagvpiilvgnKiDl.....leerevsleellelakelglpvvetSaktg------------------
00507921   1/1  lelpdvpiilvgnKiDlldrevseeealelakelglpfiet-----------------------------
00511041   1/1  lelagvpiilvgn---------------------------------------------------------
00370451   1/1  lp.agvpiilvgn---------------------------------------------------------
00515621   1/1  allagvpillvgNKiDlldalslrevsee-----------------------------------------
00449901   1/1  ldllllagvpiilvgnKiDll..e.revlleeleelakelglvpfv------------------------
00407471   1/1  lllagvpiilvlNKiDlldakllaellellrl--------------------------------------
00514711   1/1  ae..dvpiilvgNKiDlldarevseeealelake------------------------------------
00514611   1/1  le.pnvpiilv-----------------------------------------------------------
00520021   1/1  le.snvpiilv-----------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00424711   1/1  ivsdip...............gtTrdivlgvl.......gkklvliDtPGllefaseleglgkklverfl
00470231   1/1  DasdydlvllepdsferleewleelrellanpllanvpiilvgNKiDl....leelakelgl--------
00372461   1/1  ----------------------------------------------------------------------
00410321   1/1  aglagvpiilvgNKiDllealgarevseelalelak----------------------------------
00525021   1/1  lelagvpiilvgn---------------------------------------------------------
00531961   1/1  llpgvpiilvgNK---------------------------------------------------------
00528411   1/1  leagvpiilvgnKiD.lldarevsleellelakelglpvietSak-------------------------
00514601   1/1  apsnvpiilvg-----------------------------------------------------------
00362791   1/1  le.sgvpiilvgnKiDlldarevseeealela--------------------------------------
00366991   1/1  agladvpillvgnKiDllealsarevseeeal--------------------------------------
00378621   1/1  lllagvpiilvlNKiDlldaallrevleelal--------------------------------------
00527351   1/1  lpsnvpiilvg-----------------------------------------------------------
00514621   1/1  lepgvpiilvgnKiDlldarevseeealelakel------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00387321   1/1  aglenvpiilvgNKiDlldalllrevleelglelak----------------------------------
00455591   1/1  le.snvpiilv-----------------------------------------------------------
00528791   1/1  adllagvpiilvg---------------------------------------------------------
00447401   1/1  lgllllagvpiilvgnKiDll.d..revlee---------------------------------------
00414001   1/1  dasdplgiilvvnkvdpledieiisaelgladlellekllealirrp-----------------------
00526151   1/1  wleellelael-----------------------------------------------------------
00526251   1/1  ld.snvpiilvgn---------------------------------------------------------
00514721   1/1  lgpgvpiilvgnK---------------------------------------------------------
00497591   1/1  ealeeggipiilv---------------------------------------------------------
00526801   1/1  apanvpiilvg-----------------------------------------------------------
00444821   1/1  lllagvpiilvgNKiDllealslrevseelalelak----------------------------------
00481541   1/1  ellagvpiilvgn---------------------------------------------------------
00528321   1/1  llellelagvpii---------------------------------------------------------
00518311   1/1  lelagvpiilvgnKiDl.....lderevsleellelakelglpvietSakt-------------------
00465381   1/1  ----------------------------------------------------------------------
00504501   1/1  ----------------------------------------------------------------------
00387311   1/1  ld.pgvpiilv-----------------------------------------------------------
00517041   1/1  leagvpiilvgNK---------------------------------------------------------
00517841   1/1  lgsaavgdqpeeleeafraltleylreadtlillvvdasddltesdalkllkeldelg------------
00525281   1/1  leanvpiilvg-----------------------------------------------------------
00514591   1/1  apsnvpiilvg-----------------------------------------------------------
00463921   1/1  elgpgvpiilvgn---------------------------------------------------------
00518321   1/1  relglgvpiilvg---------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00412341   1/1  ldpgvpiilvg-----------------------------------------------------------
00378841   1/1  le.agvpiilv-----------------------------------------------------------
00405881   1/1  sggekqrlalarallgkpvilvlNKiDeptneldlellell-----------------------------
00516461   1/1  ----------------------------------------------------------------------
00403151   1/1  llgllllegvpillvgnKlDlptnerdvsl----------------------------------------
00514581   1/1  llklagvpiilvg---------------------------------------------------------
00507411   1/1  villVvDaseglt---------------------------------------------------------
00432181   1/1  lellrelllagkp---------------------------------------------------------
00352811   1/1  lellesillnrll---------------------------------------------------------
00492691   1/1  atdresfeeldlellellrellpgvpiilvgNKiDlldarellelllllglllvs---------------
00513761   1/1  DtpGglelrallalllaiaralaadeillvddptsgldaetqleilell---------------------
00519521   1/1  lelleeilnllllagkpillvlNKiDlldekllaelledlfpeyk-------------------------
00514501   1/1  lgagvpiilvgnK---------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00527641   1/1  ldpnvpivlvg-----------------------------------------------------------
00520981   1/1  elgl.nvpiilvg---------------------------------------------------------
00477011   1/1  ...dltlvDtPGlgsvavvdqlsggqkqrvalarallknpdtlillvedandldtesd------------
00414121   1/1  DeptlvlDaasg..edlldllkelaeqlgltvlivlnKiDlls.elthdlel------------------
00356411   1/1  gevlqllelilnltvlenvpiilvlNKiDlleekiveellel----------------------------
00481131   1/1  relaagvpiilvgnKiDlldalsllllllllglrevlleealelakelglv-------------------
00410531   1/1  aglegvpiilvgnKlDlldalllrevsaelalel------------------------------------
00527851   1/1  relgpgvpiilvg---------------------------------------------------------
00525011   1/1  ldllsnvpiil-----------------------------------------------------------
00494041   1/1  lellesilnllll---------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00440861   1/1  kltliDtpGlgdtkls------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00490731   1/1  elgadvvllvv-----------------------------------------------------------
00495821   1/1  lewleellnnallanvpillvgNKiDlleelakklgl---------------------------------
00507751   1/1  lelagvpiilv-----------------------------------------------------------
00467111   1/1  llallladvvllv---------------------------------------------------------
00515511   1/1  lnllesllvlenl---------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00475471   1/1  asegltivhvegl---------------------------------------------------------
00492901   1/1  ----------------------------------------------------------------------
00379741   1/1  ----------------------------------------------------------------------
00387941   1/1  Dtppglgdl..tllalaaadgvllVvdp------------------------------------------
00515531   1/1  lnlfpsltvlenl---------------------------------------------------------
00520051   1/1  lglllpgipillv---------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           WGVSMPSMQRTGMDFGDIMDLEQNDKRDELHERTPLSDVVLDMVCEHFPNPVDAQPRRVPRIWRGDAESE
00411701   1/1  qgpvvfgsaltgvgfllllfallyakklgldlkellkrlwgdiyfipkd---------------------
00520541   1/1  lgvvdllssfallylkglglklllleipedllelalearlelleavaeld--------------------
00374071   1/1  g...........vpvvpvsaltgegv..................................delldalvel
00504491   1/1  sekallyeggklllllipeellelaeelrealveavaelddelleklleg--------------------
00411711   1/1  ----------------------------------------------------------------------
00362391   1/1  ltgegv..................................delldallellpspelrldpl---------
00372481   1/1  tgegv..................................delldallellpvperdldkplrllvldv--
00431331   1/1  glpigvgd...........vpvvpiSAltgegvde................-------------------
00369581   1/1  ltg-------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00516481   1/1  ...-------------------------------------------------------------------
00517691   1/1  .......vpvvpiSAltglgv...............................------------------
00469361   1/1  ----------------------------------------------------------------------
00396721   1/1  ...-------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00401211   1/1  ..........vpvvpiSAltgegv..........................--------------------
00482521   1/1  -------------------------------------------------lpataeqlrvpvlygsaldgk
00484261   1/1  ----------------------------------------------------------------------
00471271   1/1  gelgllllndl..llggvpvllvevSaktgegvdeelvlgrlypwleghldfl-----------------
00494851   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00520531   1/1  -------------------------------------eeLldaivdllpsP...................
00515101   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00504521   1/1  ----------------------------------------------------------------------
00482541   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00504511   1/1  ----------------------------------------------------------------------
00520571   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00482531   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00520551   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00468241   1/1  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00424711   1/1  ryl-------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00504501   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00492901   1/1  ----------------------------------------------------------------------
00379741   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LADTMRMVNEDGEVVFMVTDISMDPHAGEIATGRVFSGTLEKGQELYVSGTAGKNRIQSVGLFMGSEREE
00411701   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00374071   1/1  lpsplle.....................l-----------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00411711   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00482521   1/1  gvqplldadpdgplvalvsklvadpdvgrflafgRvysGtlkkGdkvrvlgpgyspgdeedlkkvrvgrl
00484261   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00520531   1/1  ......kadpdgplqalvfkivydpyvgriafvrvysGtlkkgdkvlllrtgkkekvgrllvflglkree
00515101   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00504521   1/1  ----------------------------------------------------------------------
00482541   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00504511   1/1  ----------------------------------------------------------------------
00520571   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00482531   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00520551   1/1  ----------------------------------------------------------------------
00504481   1/1  ----pPkgdpdkpllalvfkvfydpyrGrvalvrvysGtlkkgdkvllv..gkkvrvgellvflgleree
00468241   1/1  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00396701   1/1  --------dldkplralvidvfldsgvgtvatgrvesGtlkvgdkvvvlpsgktgrvksllvf....ked
00424711   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00372461   1/1  -----PerdldkplrllvqdvfkdsgvgtvatgrvesGtlkvgdkvrvlgtlpsvlvgevksllrf.red
00410321   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------dkplrllvqdvfkisgvgtvvtgrvesGvvkvgdkvlvlpsgktvevksievf....ree
00387321   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00465381   1/1  --------dldkplrllvqdvfkisgvGtvvtgrvesGvikvgdkvlilpsgkvlkvkvksievf..rke
00504501   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00362371   1/1  ------krdldkplrllvldvflisgrGtvvtgrvesGvlkvgdkvvllpsgviltgkvksiemf..kkd
00412341   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00516461   1/1  -------rdldkplrlpvqdvfrisgvgtvvtgrvesGvlkvgdevlvlpsgktvrvksievf....dee
00403151   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00504201   1/1  -------rdldkplrlpvqdvfkisgvgtvvtgrvesGvikvgdevrvlpsglttkvksievf....ked
00527641   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00401191   1/1  -----PerdldkplrlpvqdvfdingpgtdlddlrGvVvtgrvesGvlkvGdeveilpllllkeggklll
00379751   1/1  ---------vvfPlrlpildvfvingvgtvvvGvrVlsGvlkvgdpvlvlpggkvgevkslern....ke
00440861   1/1  ----------------------------------------------------------------------
00491101   1/1  ----pPerdldkplrlpvqdvf..kgvgtvvtGrvesGvvkvgdevlvlpsg...kttkvksiemldkve
00490731   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00450341   1/1  ----lPerdedkpfrlpvqdvfkisg.gtvaggrvesGvikvgdkvrvlpsg......gkvkslerfked
00475471   1/1  ----------------------------------------------------------------------
00492901   1/1  -------rdldkpfrlpvervfdingpgtelddlrGtVvtGtvlsGvlkvGdeveilplllvkeegklkl
00379741   1/1  ---------pdgpakgtvlevkldkglGtvatvlvqnGtLkkgdlivvaglngpivgrvralltpkplke
00387941   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VDRVPAGNIASVTGLRDAIAGSTVSSVEMTPFESIEHISEPVITKSVEAQNMDDLPKLIETLQQVAKEDP
00411701   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00411711   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00482521   1/1  llfmgrereevdeapaGdivaivglddaiikgdtl-----------------------------------
00484261   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00520531   1/1  vdealaGdivavvglkdikvgdtltdaenpvalpllgf--------------------------------
00515101   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00504521   1/1  -------------------------------------vpePvlsvaiepkdssdlgklleaLeklaeedp
00482541   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00504511   1/1  ----------------------------------------------------------------------
00520571   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00482531   1/1  -----------------------------------lpfpePvlfvavepkdksdleklleaLeklaeedp
00399991   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00520551   1/1  ----------------------------------------------------------------------
00504481   1/1  vdealaGdivaivglkdirvGdtltdpenplalellgfd-------------------------------
00468241   1/1  -------------------------------------fpePvlfvavepkdpsdlkkllkaLekLaeedp
00520561   1/1  -------------------------------------fpePvlfvavepkdpsdlkkllkaLekLaeedp
00444161   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00396701   1/1  vdealaGdivgillkgvglkdikvGdtltap---------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00372461   1/1  vdeavaGdivglllkgvglkdikrGdvltdp---------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00374051   1/1  vdealaGdivglllkgvdlkdirrGdvltdpgnp------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00465381   1/1  vdeavaGdivglllkgvdledirrGdvl------------------------------------------
00504501   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00362371   1/1  vdealagdivglllkgigledvrrGdvltvp---------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00516461   1/1  veeavagdivgltlkgvedisrGdvlvdpdn---------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00504201   1/1  vdeavagdnvglllkgvdvedisrGdvl------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00401191   1/1  lglttkvksievf....rkeleealagdlvgl--------------------------------------
00379751   1/1  dvkearaGdevaialkgvtvgrdikrgdvlyvlesres......advlilvlredltlgdlpllhillkl
00440861   1/1  ----------------------------------------------------------------------
00491101   1/1  ldeavaGdnvgllllgieedisrGdvlvdpg---------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00450341   1/1  veeAvaGdevglllegiiedikrGdvlla-----------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00492901   1/1  eglttkvksleaf....gkeleeavagdlvgl--------------------------------------
00379741   1/1  lrvkddngkevkeagpalpveilgldle------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           TIQIEINEDTGEHLISGQGELHLEVITQRIRDNQGIPVITGEPIVVFREQPQEASREVEGQSPNRHNKFY
00411701   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00411711   1/1  --------------------------------------------VsyrEtvveessllvlskspnkhnrl
00362391   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00504521   1/1  slrvevdeetgelilsglGelhleillerL.reygvevivskprV-------------------------
00482541   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00504511   1/1  ----------------------------------------------------------------------
00520571   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00482531   1/1  sllvevd.etgelilgglGelhlevvlerLereyagvevilseP--------------------------
00399991   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00520551   1/1  ------------------------------------------PqVaYrEtitkkveveglfkkqsggkgq
00504481   1/1  ----------------------------------------------------------------------
00468241   1/1  slvvevdeetgelilgglGelhlevllerLkreygvevilgapsva------------------------
00520561   1/1  slvvevdeetgelilgglGelhlevllerLkreygvevilge----------------------------
00444161   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00504501   1/1  ---------------------------------------------aYrEtitkkvevvgkfkkqsggkgq
00387311   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00379751   1/1  l---------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00492901   1/1  ----------------------------------------------------------------------
00379741   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           LTVEPMAQEIVDAIQLGEVSMDMPELERREALQEAGMDKDTSQNVEDIHRTNILIDDTKGIQHLNETMEL
00411701   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00411711   1/1  ylraePlpeeltelieegklsleddlkelakllaekygwdvdaarkiwafGPertgpnilvdltkgvqyl
00362391   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00504521   1/1  ----------------------------------------------------------------------
00482541   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00504511   1/1  ----------------------------------------------------------------------
00520571   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00482531   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00520551   1/1  yaevllllePlerg........................................sglefvdevvggvipk
00504481   1/1  ----------------------------------------------------------------------
00468241   1/1  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00504501   1/1  yaevllllePleg...........................................lefvnevvggvlpk
00387311   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00492901   1/1  ----------------------------------------------------------------------
00379741   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           VLEGLQEALDDGPLAAEPVQGSLFRLHDAKLHEDTIHRGPAQVIPAVRNAVHRSLIDGEVRLLEPIQDVR
00411701   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00411711   1/1  neikdsivsGFqlatkeGPLaeepvrgvkfvlldvtlhedaihrgggqiipavrraiyaalll-------
00362391   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00504521   1/1  ----------------------------------------------------------------------
00482541   1/1  ---------------------------------------------------------------EPimlve
00374121   1/1  ----------------------------------------------------------------------
00504511   1/1  ------------------------------------------------------------vllEPivkve
00520571   1/1  ------------------------------------------------------------vllEPivkve
00361531   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00482531   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00520551   1/1  efipavekglrealesGplagypvvdvkvtlldgsyhev..dsselafriaarlalrea-----------
00504481   1/1  ----------------------------------------------------------------------
00468241   1/1  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00504501   1/1  eyipavekglrealesGvlagypvvdvkvtLldgsyhev..dsselaFkiAaslafrea-----------
00387311   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00492901   1/1  ----------------------------------------------------------------------
00379741   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           IDVPSEHMGAASGEIQGRRGRVDDMYQEGDLMVVEGIAPVEEMIGFSSDIRSATEGRASWNTENAGFRVL
00411701   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00411711   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00504521   1/1  ----------------------------------------------------------------------
00482541   1/1  ilvpeeylgdvigllnkRrGeilgmelldgtglvlikalvPlaelfgfateLrslTsGrasfslefdhye
00374121   1/1  ----------------------------------------------------------------------
00504511   1/1  ilvpeeylgdvigllskrrGeilgmellgglvvlealvPlaelfgfateLrslTsGraslslefsgyepv
00520571   1/1  ilvpeeylgdvigllskrrGeilgmellgglvvlealvPlaelfgfateLrslTsGraslslefsgyepv
00361531   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00482531   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00520551   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00468241   1/1  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00504501   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00492901   1/1  ----------------------------------------------------------------------
00379741   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           VDNLQREKIMEIRERKGMKLELPQSIDYF-----------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00411711   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00504521   1/1  ----------------------------------------------------------------------
00482541   1/1  pvpgdildrligelellesg--------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00504511   1/1  pgdlldilingvlvda------------------------------------------------------
00520571   1/1  pgdlvdeli-------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00482531   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00520551   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00468241   1/1  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00504501   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00492901   1/1  ----------------------------------------------------------------------
00379741   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------