[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for hlac0:ACM56614.1


[Show Plain Result]

## Summary of Sequence Search
   1::221
   2::219  7.7e-33 29.9% 0052182 00521821 1/1   nosyl-L-methionine-dependent methyltran 
  28::221    2e-24 25.8% 0049474 00494741 1/1   nosyl-L-methionine-dependent methyltran 
  35::218  2.3e-24 30.1% 0052001 00520011 1/1   nosyl-L-methionine-dependent methyltran 
  32::215  1.2e-19 27.7% 0046354 00463541 1/1   nosyl-L-methionine-dependent methyltran 
  31::162  6.9e-18 25.0% 0048490 00484901 1/1   nosyl-L-methionine-dependent methyltran 
  40::166  1.9e-17 24.4% 0051930 00519301 1/1   nosyl-L-methionine-dependent methyltran 
  28::160  2.5e-17 26.9% 0047923 00479231 1/1   nosyl-L-methionine-dependent methyltran 
  40::175    3e-17 24.3% 0051823 00518231 1/1   nosyl-L-methionine-dependent methyltran 
  34::217  4.5e-17 26.8% 0047580 00475801 1/1   nosyl-L-methionine-dependent methyltran 
  45::162  4.7e-17 25.4% 0049915 00499151 1/1   nosyl-L-methionine-dependent methyltran 
  43::174  1.2e-16 22.5% 0050745 00507451 1/1   nosyl-L-methionine-dependent methyltran 
  49::173  1.6e-16 25.6% 0047676 00476761 1/1   nosyl-L-methionine-dependent methyltran 
  35::175  2.1e-16 26.8% 0049122 00491221 1/1   nosyl-L-methionine-dependent methyltran 
  40::175  3.9e-16 24.2% 0049532 00495321 1/1   nosyl-L-methionine-dependent methyltran 
  36::157  7.2e-16 24.8% 0053107 00531071 1/1   nosyl-L-methionine-dependent methyltran 
  28::162  7.5e-16 26.8% 0044689 00446891 1/1   nosyl-L-methionine-dependent methyltran 
  44::159  8.4e-16 27.6% 0047471 00474711 1/1   nosyl-L-methionine-dependent methyltran 
   4::174  9.9e-16 23.7% 0050919 00509191 1/1   nosyl-L-methionine-dependent methyltran 
  25::155  1.3e-15 28.1% 0047329 00473291 1/1   nosyl-L-methionine-dependent methyltran 
  32::177  1.3e-15 26.6% 0046696 00466961 1/1   nosyl-L-methionine-dependent methyltran 
  31::174  1.8e-15 26.1% 0049671 00496711 1/1   nosyl-L-methionine-dependent methyltran 
  29::160  2.1e-15 26.2% 0052649 00526491 1/1   nosyl-L-methionine-dependent methyltran 
  44::159  2.2e-15 25.0% 0050988 00509881 1/1   nosyl-L-methionine-dependent methyltran 
  34::172  2.4e-15 25.2% 0046744 00467441 1/1   nosyl-L-methionine-dependent methyltran 
   6::162  3.2e-15 24.5% 0047919 00479191 1/1   nosyl-L-methionine-dependent methyltran 
  45::161  5.2e-15 26.5% 0051885 00518851 1/1   nosyl-L-methionine-dependent methyltran 
  44::170  5.9e-15 27.8% 0053110 00531101 1/1   nosyl-L-methionine-dependent methyltran 
  43::174  6.1e-15 28.8% 0049885 00498851 1/1   nosyl-L-methionine-dependent methyltran 
  34::177  6.7e-15 27.5% 0051944 00519441 1/1   nosyl-L-methionine-dependent methyltran 
  34::168  7.7e-15 23.3% 0050762 00507621 1/1   nosyl-L-methionine-dependent methyltran 
  34::155  1.1e-14 24.6% 0051261 00512611 1/1   nosyl-L-methionine-dependent methyltran 
  40::180  1.1e-14 26.5% 0051143 00511431 1/1   nosyl-L-methionine-dependent methyltran 
   1::174  1.6e-14 24.1% 0051657 00516571 1/1   nosyl-L-methionine-dependent methyltran 
  45::174  1.6e-14 25.4% 0039093 00390931 1/1   nosyl-L-methionine-dependent methyltran 
  25::183  1.8e-14 22.3% 0052807 00528071 1/1   nosyl-L-methionine-dependent methyltran 
  32::175  2.9e-14 25.0% 0046931 00469311 1/1   nosyl-L-methionine-dependent methyltran 
  28::165  3.9e-14 21.9% 0051449 00514491 1/1   nosyl-L-methionine-dependent methyltran 
  37::174  4.6e-14 25.4% 0050234 00502341 1/1   nosyl-L-methionine-dependent methyltran 
  40::161    5e-14 26.3% 0043085 00430851 1/1   nosyl-L-methionine-dependent methyltran 
  26::174  5.6e-14 28.0% 0045060 00450601 1/1   nosyl-L-methionine-dependent methyltran 
  42::174    1e-13 26.4% 0041580 00415801 1/1   nosyl-L-methionine-dependent methyltran 
  33::174  1.1e-13 25.2% 0048438 00484381 1/1   nosyl-L-methionine-dependent methyltran 
  32::182  1.3e-13 24.6% 0051103 00511031 1/1   nosyl-L-methionine-dependent methyltran 
  21::177  1.5e-13 25.7% 0041444 00414441 1/1   nosyl-L-methionine-dependent methyltran 
  43::180    3e-13 28.0% 0044550 00445501 1/1   nosyl-L-methionine-dependent methyltran 
  47::156  3.2e-13 27.1% 0050935 00509351 1/1   nosyl-L-methionine-dependent methyltran 
  26::174  3.5e-13 24.1% 0047851 00478511 1/1   nosyl-L-methionine-dependent methyltran 
  35::211  4.8e-13 22.7% 0047386 00473861 1/1   nosyl-L-methionine-dependent methyltran 
  30::193  8.6e-13 25.9% 0049171 00491711 1/1   nosyl-L-methionine-dependent methyltran 
  21::173  9.2e-13 25.9% 0049074 00490741 1/1   nosyl-L-methionine-dependent methyltran 
  45::155    1e-12 27.3% 0052739 00527391 1/1   nosyl-L-methionine-dependent methyltran 
  45::155    1e-12 28.7% 0052749 00527491 1/1   nosyl-L-methionine-dependent methyltran 
  25::183  1.6e-12 23.2% 0050154 00501541 1/1   nosyl-L-methionine-dependent methyltran 
  44::160  1.6e-12 24.6% 0048629 00486291 1/1   nosyl-L-methionine-dependent methyltran 
  25::159  5.8e-12 27.8% 0051884 00518841 1/1   nosyl-L-methionine-dependent methyltran 
  45::155  7.1e-12 27.0% 0053229 00532291 1/1   nosyl-L-methionine-dependent methyltran 
  38::211  8.6e-12 22.4% 0049719 00497191 1/1   nosyl-L-methionine-dependent methyltran 
  49::161    1e-11 27.7% 0040964 00409641 1/1   nosyl-L-methionine-dependent methyltran 
  35::154  1.5e-11 27.0% 0051617 00516171 1/1   nosyl-L-methionine-dependent methyltran 
  39::163    2e-11 27.6% 0051840 00518401 1/1   nosyl-L-methionine-dependent methyltran 
  36::154  3.4e-11 27.1% 0050693 00506931 1/1   nosyl-L-methionine-dependent methyltran 
   1::174  4.3e-11 28.3% 0053077 00530771 1/1   nosyl-L-methionine-dependent methyltran 
   6::211  4.4e-11 23.9% 0046838 00468381 1/1   nosyl-L-methionine-dependent methyltran 
  31::207  7.6e-11 21.8% 0040829 00408291 1/1   nosyl-L-methionine-dependent methyltran 
  35::155  8.5e-11 26.3% 0050749 00507491 1/1   nosyl-L-methionine-dependent methyltran 
  32::198  1.2e-10 22.6% 0037982 00379821 1/1   nosyl-L-methionine-dependent methyltran 
  25::211  1.3e-10 26.9% 0050242 00502421 1/1   nosyl-L-methionine-dependent methyltran 
   3::155  1.7e-10 25.8% 0049442 00494421 1/1   nosyl-L-methionine-dependent methyltran 
  39::219  1.9e-10 23.8% 0040196 00401961 1/1   nosyl-L-methionine-dependent methyltran 
  34::155    2e-10 27.5% 0048774 00487741 1/1   nosyl-L-methionine-dependent methyltran 
  26::183  2.5e-10 28.5% 0042197 00421971 1/1   nosyl-L-methionine-dependent methyltran 
   8::198  2.6e-10 22.0% 0046840 00468401 1/1   nosyl-L-methionine-dependent methyltran 
   1::162  3.1e-10 26.5% 0048805 00488051 1/1   nosyl-L-methionine-dependent methyltran 
  10::174  6.3e-10 21.7% 0041326 00413261 1/1   nosyl-L-methionine-dependent methyltran 
  36::155  6.5e-10 25.0% 0052693 00526931 1/1   nosyl-L-methionine-dependent methyltran 
  15::211  7.1e-10 25.4% 0047211 00472111 1/1   nosyl-L-methionine-dependent methyltran 
  31::163  7.1e-10 22.0% 0035026 00350261 1/1   nosyl-L-methionine-dependent methyltran 
  23::177  1.3e-09 23.0% 0047465 00474651 1/1   nosyl-L-methionine-dependent methyltran 
  11::162  1.4e-09 19.6% 0036610 00366101 1/1   nosyl-L-methionine-dependent methyltran 
   5::174  1.6e-09 26.9% 0051679 00516791 1/1   nosyl-L-methionine-dependent methyltran 
  25::161  2.3e-09 25.4% 0045109 00451091 1/1   nosyl-L-methionine-dependent methyltran 
  13::182  2.5e-09 25.8% 0052536 00525361 1/1   nosyl-L-methionine-dependent methyltran 
  16::173  2.9e-09 24.0% 0051842 00518421 1/1   nosyl-L-methionine-dependent methyltran 
  35::174  3.1e-09 25.2% 0051239 00512391 1/1   nosyl-L-methionine-dependent methyltran 
  43::172  1.1e-08 25.0% 0052709 00527091 1/1   nosyl-L-methionine-dependent methyltran 
  34::130  2.1e-08 27.2% 0042682 00426821 1/1   nosyl-L-methionine-dependent methyltran 
  39::174  2.3e-08 20.9% 0052084 00520841 1/1   nosyl-L-methionine-dependent methyltran 
  46::174  5.8e-08 23.4% 0047945 00479451 1/1   nosyl-L-methionine-dependent methyltran 
  49::213    9e-08 22.6% 0041593 00415931 1/1   nosyl-L-methionine-dependent methyltran 
  42::130  1.2e-07 22.5% 0052510 00525101 1/1   nosyl-L-methionine-dependent methyltran 
  45::154  2.7e-07 29.8% 0046568 00465681 1/1   nosyl-L-methionine-dependent methyltran 
   2::131  3.1e-07 26.5% 0047656 00476561 1/1   nosyl-L-methionine-dependent methyltran 
  49::155  3.3e-07 28.6% 0050519 00505191 1/1   nosyl-L-methionine-dependent methyltran 
  46::155  2.7e-06 24.8% 0052618 00526181 1/1   nosyl-L-methionine-dependent methyltran 
  35::155  5.7e-06 23.1% 0053087 00530871 1/1   nosyl-L-methionine-dependent methyltran 
  49::155  8.2e-06 26.4% 0049778 00497781 1/1   nosyl-L-methionine-dependent methyltran 
  18::169  1.2e-05 18.7% 0040327 00403271 1/1   nosyl-L-methionine-dependent methyltran 
  35::131  1.8e-05 24.2% 0036976 00369761 1/1   nosyl-L-methionine-dependent methyltran 
  44::155  2.9e-05 26.9% 0047862 00478621 1/1   nosyl-L-methionine-dependent methyltran 
  35::128  5.8e-05 26.1% 0049069 00490691 1/1   nosyl-L-methionine-dependent methyltran 
  29::172  0.00095 19.9% 0042366 00423661 1/1   )-binding Rossmann-fold domains         
  35::115  0.00096 27.6% 0047303 00473031 1/1   nosyl-L-methionine-dependent methyltran 
   1::221


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDILSDSAERFLAATAPEHTATQVEMAALADDWGFPISGPEAGAVLRLLARLTDAERVFEFGSGFGYSAT
00521821   1/1  -diteeelleyvlrhsfvpdpllllalrdealdvggglpilspekgalllellrllpgkrvLdiGtGtGy
00494741   1/1  ---------------------------kngikdeilldyilsrprgepldelldeyedyalkfglgllii
00520011   1/1  ----------------------------------llletliellldlgrdllldervddylrdlikglpe
00463541   1/1  -------------------------------renlvdnlaehydllnevleallkvprelflpevplrel
00484901   1/1  ------------------------------lllldkllkllkpgdlvllllannlllpltlrvnklkltr
00519301   1/1  ---------------------------------------vllslfaerlvealkllkklllkglvnayrl
00479231   1/1  ---------------------------efyddyalsfdeglrptqeellelllellglkpgkrvLDlGcG
00518231   1/1  ---------------------------------------idcallaerlnkalellkdllkklevlrlil
00475801   1/1  ---------------------------------gvlisqpellalllelldlkpgdrvLDiGcGtGylal
00499151   1/1  --------------------------------------------Llvlgllielltpglrlllkvdelll
00507451   1/1  ------------------------------------------llvlllllllalnkalkllrdllrklgl
00476761   1/1  ------------------------------------------------lldllsllllelglvlsdeqle
00491221   1/1  ----------------------------------mstvplselskklaeeffydlaadfydllldglfps
00495321   1/1  ---------------------------------------tigellrealalleeagldlldaelllllll
00531071   1/1  -----------------------------------Gplriilgefrglklkvdpgvlirpttdrlrelll
00446891   1/1  ---------------------------Mveklirkhyildeevleaflkvprelfvpeplyslayfdgle
00474711   1/1  -------------------------------------------ldgwfteilwpglrlllkldellheek
00509191   1/1  ---klleleedvrslfldyaelydgdnllleelgdgvmraqeralmallallglrpggrVLDvGcGtGgl
00473291   1/1  ------------------------vkllkegdrvllelgrplmllellregglldtrlgiepledllgvp
00466961   1/1  -------------------------------dlsndlyelyldlydlyssaydllgdrpltdallealle
00496711   1/1  ------------------------------nsvsglfdsiashydllndlyellldedyfysygyfddyg
00526491   1/1  ----------------------------ddlyddglsliqrellelllelldlllkpgkrvLDiGcGtGg
00509881   1/1  -------------------------------------------kalldillwliellslglalslkidkl
00467441   1/1  ---------------------------------ikrlvvllvlkglllsrlladalilvprhydlgedly
00479191   1/1  -----Ydlgndlyellldedyfysdayyddpgdllrpaqerllelllellg.lkpgkrvLDiGcGtGgla
00518851   1/1  --------------------------------------------eldgqlldlllklikeklkknlglnl
00531101   1/1  -------------------------------------------alaaalaglakgkrvLDlgcGtGglsl
00498851   1/1  ------------------------------------------darlllglllglslllleayldlvldee
00519441   1/1  ---------------------------------slprwlvinllkllgeellealleallellplvlrvn
00507621   1/1  ---------------------------------veehydelaefydkllgelliprpateellelllell
00512611   1/1  ---------------------------------gteilqpadlalilellglkpgdrvLDiGcGsGgltl
00511431   1/1  ---------------------------------------qrellelllellg.lkpgkrvLDiGcGtGgl
00516571   1/1  pedevkelirsfydraadrydgqnrlleelgdgvmlaqerall..rllallglrpggrvLdvGcGtGlla
00390931   1/1  --------------------------------------------ahllllllkppkrvLdiGgGtGglar
00528071   1/1  ------------------------fdsyayfydalnllqlrprtealleallellglkpgkrvLDlGcGt
00469311   1/1  -------------------------------erlfdeyaefydlanglglrprqeallelllellp.lkp
00514491   1/1  ---------------------------GadeyfefgpryiqepllelllelldlllkpgkrvLDiGcGtG
00502341   1/1  ------------------------------------al..klelllellg.lkpgkrvLDiGcGtGglal
00430851   1/1  ---------------------------------------msetetdfglarlklieeliashydlsvdvl
00450601   1/1  -------------------------Mssteklsplliehkelveefydslaerydelrgvllrpaqrall
00415801   1/1  -----------------------------------------mekkelldwiaelldlgldlykleaelll
00484381   1/1  --------------------------------seildglvivgkydlskdlfeeflgdydlvlafldglr
00511031   1/1  -------------------------------kllelldldidllklsllklkkinklyknlknlilknts
00414441   1/1  --------------------tysagyydlpadilrpateelldlllellg.lkpgdrvLDlGcGtGglal
00445501   1/1  ------------------------------------------drveppcphfgecggcqlqhlsyeaqle
00509351   1/1  ----------------------------------------------nmllelllklllllglnlseeqye
00478511   1/1  -------------------------klkksfdnvakhYdlgndlyslildpdmfysygyyddpdetlrpa
00473861   1/1  ----------------------------------melfdevaeryddfadglspgqdrllelllellael
00491711   1/1  -----------------------------skyywdefyrplldallell.glkpgkrvLDlGCGtGglll
00490741   1/1  --------------------ledllrayllllpellllleslenladhldlgnppfelllgeeffeyfak
00527391   1/1  --------------------------------------------ypmriiagkfrgrkllvppglftrpt
00527491   1/1  --------------------------------------------rlrvlellkpgetVlDlgaGiGilal
00501541   1/1  ------------------------dvaeyfddiaavydgfaeglreaaeallelllellppgkrvLDiGc
00486291   1/1  -------------------------------------------sydniaihydmlndrprteallealle
00518841   1/1  ------------------------dlikegdlvllllsrgnlllvllkllneggvlntrygvlkhddlig
00532291   1/1  --------------------------------------------ahlllllhpnpkrvLdiGgGtGglar
00497191   1/1  -------------------------------------llllralllllelvelllelleklldsllkgei
00409641   1/1  ------------------------------------------------wfterltpekafslkveevlye
00516171   1/1  ----------------------------------Qnfltdpalldailell.glkpgdrVLDiGcGtGal
00518401   1/1  --------------------------------------qvmlklikkqikeypqdklvripekaslyllv
00506931   1/1  -----------------------------------llriiggkfrgrkllvppgprptterlrealfnll
00530771   1/1  keyydeiaery.......................dpaqrallelllellg.llpggrvLDlGCGtGrlal
00468381   1/1  -----edsllplllllldpllleallslleallegkydllellfgkelfeylagdaelydlfndglrpgs
00408291   1/1  ------------------------------vlipfehqevlleellellk.lkpgkrvLDlGcGtGglal
00507491   1/1  ----------------------------------egeplriilgkleglklkldpgqafltprpvtellv
00379821   1/1  -------------------------------gegvvkpqdegatiwaphrsrlaaklaeilelldlkpGd
00502421   1/1  ------------------------dvkdfydelaelyddlldelsdalldlllell.glkpgkrvLDiGc
00494421   1/1  --lpgllidrliqllgeelealleallealplllrvntlkisldellelleglgielrllpllplayilg
00401961   1/1  --------------------------------------Mskkdlkeavaeyydlfadfydllldpnfhys
00487741   1/1  ---------------------------------hqnfvnpllaklleal.dlrpgdrVLdlgcGtGrlal
00421971   1/1  -------------------------Msdcplcpesltpsellykeevarvfdriaerydrlrpvpsplyy
00468401   1/1  -------lslapllllllddvlleawlslldallegrldllellyglglfeylaldaevydafldglrpa
00488051   1/1  vnvlkidseevleallkegrellltpglvpgksvygedygdplgeearlwdprrsrlaaklalilellg.
00413261   1/1  ---------rskrvpleyilgeadfyglpldvggafltprpitellleallelgllkgkrvLDlGcGtGi
00526931   1/1  -----------------------------------pttdrvrealfnilapllegkrvLDlfaGsGalgl
00472111   1/1  --------------nsdmsddefdpkkyldefyddyagrffrlreilrllldellall.gllpggrvLDv
00350261   1/1  ------------------------------nvTsffrdpehfdalaelllpllpglrvLdlGcGtGeepy
00474651   1/1  ----------------------leddllplliryslpdwlvellldllgeeleallealllplpldlrvn
00366101   1/1  ----------mserliklepekyillelkflglrfkvdpgvffptgldldtelllell.dlkkgkrvLDl
00516791   1/1  ----vlgnddyqeefdpealadefyalaseydpldrllllllerllellslglkpggrvLDvGcGtGlla
00451091   1/1  ------------------------ddlakflgqnfltdpellelilell.nlkpgdtvLDiGcGtGaltl
00525361   1/1  ------------lkvdkeeiakfydlaaeyydlvyatedgylgglflfngadleesaefladlllellgl
00518421   1/1  ---------------Mkekvkeyyde..laerydllrgslplrpaaealldlllellppggrvLDlGcGt
00512391   1/1  ----------------------------------elydklaefYdkllgsrllyeelldlllellpelll
00527091   1/1  ------------------------------------------qnhYDlsndfyelfldpsmtyssgyfed
00426821   1/1  ---------------------------------qnfltdpeilekilelldlkegdrvLdiGcGtGaltl
00520841   1/1  --------------------------------------elvlsslmdaefWderydegetgfdlgepnpl
00479451   1/1  ---------------------------------------------etlgellklrlnklikeefdlgnkf
00415931   1/1  ------------------------------------------------lldlkpgdvvlDiGcGtGglal
00525101   1/1  -----------------------------------------ladvlanvlldirksekvldlGcGtGlll
00465681   1/1  --------------------------------------------gyvsrgalklqelleklgllkpgerv
00476561   1/1  -dlyndlfelfldhsseyalinqllleelv.............ellldlldlkpglkvLDiGcGtGelal
00505191   1/1  ------------------------------------------------llapkpggrvlDlgcGtGghsl
00526181   1/1  ---------------------------------------------lqeitedllellfnallllienlld
00530871   1/1  ----------------------------------fyTPreivellvelld.pkpggrvlDpgcGsGgfll
00497781   1/1  ------------------------------------------------klglkpgdtvlDlGcGtGnlai
00403271   1/1  -----------------dgdsllplvllelsdellrafldllealregepafelafgkdffeylakdpdl
00369761   1/1  ----------------------------------hptpkPlallerlilllskpgdlVLDpfaGsGttai
00478621   1/1  -------------------------------------------lvaalvddlnpgekvLdvGcGsGllla
00490691   1/1  ----------------------------------Qnfltdpnlldkivell.dlkpgdrvLEiGcGtGal
00423661   1/1  ----------------------------lplelgalvltlatavralllagvlpgakVlvlGaGvvGlqa
00473031   1/1  ----------------------------------prellkeflkakkslgqnfltdpnladkivelld.l


                         -         -         *         -         -         -         -:140
query           WFLRGGADAVICAEFDEEEAKRGVQFAADGGYADSVTFEVGDAMETIERYDGPFDVVLIDHLKGRYADAY
00521821   1/1  salalaralppga.rvvavdispealalarenleaaGledrvtvilgdaedllpqllaplpdgkfDlifl
00494741   1/1  qpellalllelldlkpgkrvLDiGcGtGglalalakllppga.kvtgvDispealelarenakenglpnr
00520011   1/1  allaledfadllykyaylfswrgrliiklpedgallrlllaelkpkriLElGcgtGgsllllaealkllg
00463541   1/1  ayedeflpitlevgegllisqpetlalllellglkpgkrvLDiGcGtGylalalarlggpdgrvvavDis
00484901   1/1  fgllnvlelsgknavahydlsndvyellldpaysdslarfgegntllqpelaelllelldlkpgkrvLDi
00519301   1/1  vlgegdllrglavdrypdwlvvlllsalgeeelealleallellpdlrvnllkisreeklllrreeilpl
00479231   1/1  tGglalalaklgp.kvtgvDispealelarenakelglddnvefivgDaedlp..lpdgsfDlivsdppl
00518231   1/1  regdglpglavdrygdwlvvlllealgeeeleelleallellpelrvnllkisredlleelldelielll
00475801   1/1  alaklvg.grvtavdispealelarenaerlgl.dnvevilgdaeellfe.dgsfDlvvsdaplph...l
00499151   1/1  serskyqeirvyelgddgrvllldgllqgsslderqrallllllallglkpgkrvLDiGcGtGglalala
00507451   1/1  payrlvlgegdllrglavdrygdwlvvlllselgleelealleallellppidlrvnklkisreelgepv
00476761   1/1  klealldllldwnpvinltgsrefdelwlrvlldllallplkpgkrvLDlGcGtGllalalakllpgarv
00491221   1/1  qrelldlllell.glkpgkrvLDlGcGtGglalalakrga.rvtgvDispemlelarenaaelglsdadd
00495321   1/1  gldrlrlllllllplsvlelllllellerrllgepveyllgerefyglafkvgggvftprpttelllell
00531071   1/1  elladllkgkrvLDlgcGtGglalalakrgakkvtgvDispealelarenaklngldednvefiqgdald
00446891   1/1  alkflgqnflsapellalllelldlkpgkrVLDiGcGtGyltlllaklgg.kvtgvDiseemlelarenl
00474711   1/1  skyqiiriydlgndgrvllldglvlgsrpdeaqerllllllallplkpgkrvLDiGcGtGglalalakrg
00509191   1/1  alalaeagpeevtgvDispemlerareraaelg..pnvrvlvgdaeellpplpdgsfDavlsDppgssev
00473291   1/1  rglfldlavgylvlilrpltedlveafgrgtqitqpavaalllellglkpGarVLDlGcGtGaltlalar
00466961   1/1  ll.glkpgkrvLDlGcGtGglalalakrgakrvtgvDisp.mlelarenaaenglpnrvefivgDaedl.
00496711   1/1  lglrpaqeallelllellg.lkpgkrvLDiGcGtGglalalakalga.rvtgvDispemlelarenaael
00526491   1/1  lalalakllpg.akvtgvDispemlelarenakelglpn.vefivgDaedlpellpdgsfDlivsnpPyp
00509881   1/1  leeekskyqiiriydlgnfgyelfldgrllysrldeaqytelllllllldlkpgkrvLDiGcGtGglala
00467441   1/1  geelakvyddlaafldglrsrqeallelllellg.lkpgkrvLDlGcGtGglalalakllgagrvtgvDi
00479191   1/1  lalakalga.rvtgvDispemlelareraaelglpnrvefvvgDaedl....dgsfDlvvsnavlhhlpl
00518851   1/1  dllplgegqyieelwpglalslkvdevlhekkskyqiiriydlgndgrrlfldggvqysrlderqleell
00531101   1/1  aaakaga.eVtgvDispealelareNaalngleddnvefiqgDafeflkrlakegekfDliilDPPyfgl
00498851   1/1  elerllellerlaerypllksllselndrdweeaylkglrpfrgldflvipavldprpdgerlvldpglf
00519441   1/1  ellaelgielerdelgppllyllggvefadlplyktgvfitqdeasallaelldlkpgdrVLDlgaGsGg
00507621   1/1  g.lkpgkrvLDlGCGtGrlalalakrgp.evtgvDispemlelArerakengl..nvefiqgDaed.lpf
00512611   1/1  alarlvgpegrvtavDiseealelarenlerlglddnveviqgDaed..plpdgsfDaivs.dl.pdpwe
00511431   1/1  alalakrgp.rvtgvDispemlelareraaelglpn.vefvvgDaed.lpfpdgsfDlvvsnavlhhl.p
00516571   1/1  lalaeagpaevtgvDispemlerareraaeag..pnvrvlvgdaedllpplpdgsfDavlsDppsevlhh
00390931   1/1  ellkhgpvakvtgvdidpevielarenfklnglalddprvevivgDaleflkeldekfDviilDlpdpil
00528071   1/1  GglalalakrgakrvtgvDisp.mlelarenaaenglpnrvefivgDaedl.plpdgsfDlvvsnplpfv
00469311   1/1  gkrvLDlGcGtGglalalaklgpkrvtgvDisp.mlelarenaaenglpnrvefivgDaedlleplpd.f
00514491   1/1  glalalakllpgakvtgvDispemlelarenakelgl.pnvefivgdaedlpellpdgsfDlivsnpPyp
00502341   1/1  alakrg.arvtgvDispemlelareraaelgl.pnvefvvgDaed.lpfpdgsfDlvvsnavlhhlpd..
00430851   1/1  ealldvpreyfvlepayedlalafgtgvhilrpellalllellledlkpgarVLDiGcGsGyltlalarl
00450601   1/1  elllellg.llpgkrvLDvGCGtGllslalaerga.eVtgvDiseemlelAreraaengldpgadnvefv
00415801   1/1  devlgldraglllgdrgltleelakflelierrlegepleyllglyeflglefgtgpgvfiprpttelll
00484381   1/1  sraerllelllellglkpgkrvLDlGcGtGglalalakllgagrvtgvDispealelarenakrlg...n
00511031   1/1  nvskeeiakfydlvadffdevaayydglfgdllslrpaqeellelllellp.lkpgkrvLDiGcGtGgla
00414441   1/1  alaravg.arvtgvDispemlelareraeelglpdnvefvvgDaedl..fpdgsfDlvvsngvlhhl.pd
00445501   1/1  lkknlleellkrlgptifsplplgyrnkaelvvrvdlkgdglglgfyekgskilvrieecpildeillel
00509351   1/1  kledyfdllldwnkkynllsskdpdrlwerhildsllllelldlkpgkrvLDlGcGtGllaialaklfpg
00478511   1/1  qelllelllellglkpgkrvLDiGCGtGllalalakrvga.rvtgvDispemlelarenakenglpnrve
00473861   1/1  lkpgkrvLDiGcGtGglalalakllgepga.rvtgvDispemlelareraaelglsdnvefvvgDaed.l
00491711   1/1  alarlgagevtGvDiseemlelArerakeaglsdnvefivgdaed.lpefpdgsfDlvvsnfvlhhlfls
00490741   1/1  vyelydafndglrpatrlllelllell.glkpgkrvLDiGcGtGglalalakalPga.rvtgvDi.peml
00527391   1/1  tdrvreallnilapllpgarvLDlgaGsGalgleaasrgaarvtaveispealelarenaallgl.dnve
00527491   1/1  paaklgakkVvaveidpeavellreNaklnglenrvevingdardllpe..ekfDvvvldppasgl.ell
00501541   1/1  GtGglalalakrgar.vtgvDispemlelareraaelgl..nvefvvgDaed.lpfpdgsfDlvvsnavl
00486291   1/1  llg.llkgkrVLDvGcGtGilslalakaGakkVtgvDisp.mlelarenaklngldnrvefiqgdaedl.
00518841   1/1  klygsfldsskgysvallrpapedltlllkrgtqivqpkdialilelldlkpGdrVLDiGtGsGgltlll
00532291   1/1  ellkhlpvekvtavEidpevielarkyfpllglalddprvevvvgDaleflkeldekfDvIildlpdpdg
00497191   1/1  pfeyllgedffeyfdddaelydgfndglsgaqelllelllellp.lkpgkrvLDiGcGtGglalalakal
00409641   1/1  akseyqqiflvdsevfgkllfldgvlqsterlefpyhealahllllnlkkgkrVLdiGcGtGglarellk
00516171   1/1  tlalakrga.rvtgvDispemlelareraaengladnvefiqgDaedl..plpd.fDlvvsnlplhhlpd
00518401   1/1  lealltglnllqrllaafllell.dlfkgkrvLdiGaGtGllllalaellppgae.vtgiDidpdaleva
00506931   1/1  llllleggrvLDlgaGsGalaleaasrga.evvavDidpeavalarenaerlglenrveviqgdafella
00530771   1/1  alarrga.rvtgvDlspemlelareraaaagl.dnvefvvgdaed.lpf.dgsfDlvvsngvlhhl.ppe
00468381   1/1  erlldlllellpllkpgkrvLDiGcGtGglalalakalPga.rvtgvDi.pemlelarer.......pnv
00408291   1/1  alakllpg.arvigvDispealelarenlkelg..dnvefiqgdaldlpellllfpdgsfDlilsDpPys
00507491   1/1  dallelgllkgkrvlDlGaGtGalslalakrgakkvvavDidpealelarenaelngl..nveviqgdal
00379821   1/1  rVLDlGcGtGgltlhlaklvgpeGkvvgvDispemlelarenleklg...nvefilgDaeelpkyllpdg
00502421   1/1  GtGglalal.....grvtgvDispemlelarer........nvefvvgdaedl.pfpdgsfDlvvssavl
00494421   1/1  erlefallpgfktglfltqrevsellaelldlkpgerVLDlgcGtGgltlalaklvgaagvvavDispea
00401961   1/1  ygyfsgefldleeaqerlldlllellg.lkpgkrvLDvGCGtGglllalakryg.arvtGiDispemlel
00487741   1/1  aLakrga.rvigvDispealeqarenaelnglvsevgdllvysadnvefivgDafdlppadlgsvdlvld
00421971   1/1  llgddeeayldlllfpgagiprplaelllelldelllkpgkrvLDiGCGtGylalalakllPgar.vtgv
00468401   1/1  tellldlllellg.lkpgkprvLDiGcGtGglalalakrlPga.rvtgvDi.pemlelarer.......p
00488051   1/1  lkpGdrVLDlGcGsGgltlhlaelvgpeGkVygvDispemlelarenleelg...nvefilgDaeellkl
00413261   1/1  laialaklGaakvtavDispealelarena......gnvefivgdaee.lp...gkfDlivsNPPyvpls
00526931   1/1  eaasrgaakvvavdispealelakenaalnglenrvevirgdalellkallkegekfDlvvlDPPyfagl
00472111   1/1  GcGtGllalalaralppga.rvtgvDlspealelarerlaeaglafdwspllkvvlelegnlelleelee
00350261   1/1  slamllleala.lagpgarvtatDispealekareglyplgllrglplellkryflkllgadgglyrvkp
00474651   1/1  tlkisleellelleklgvvleaydllgdpleyllglrefyslplfkd.glvltqdavsellvelldpkpg
00366101   1/1  GcGtGilaialakrga.kvtgvDispealelakenaklngldnrkvefiqgdaedplp..dgkfDlivsn
00516791   1/1  lllaarlga.rvtglDlspamleearkrlaelgladdwsplvkvvcelegklllleeleellrdlvnvel
00451091   1/1  alaklgp.kvtgvdiseemlelakenlkeng...nvtfihgDalel.pfpdgkfDlivsNpPynistavl
00525361   1/1  lpgkrvLDvGcGtGrltlallarlga.evtgvDlseemlevarerlaeagl.prvefvvgdaedl.pfpd
00518421   1/1  Grlalalaerga.evtgvDispemlevarer....g...nvefvvgdaed.lpfpdgsfDlvvssfgvlh
00512391   1/1  kgkrvLDlGCGtGrltlalakrga.kvtgvDiseemlevArerakeagl..nvefivgdaed.lpf.dgs
00527091   1/1  pgesleeaqeakldllldklg.lkpgkrvLDiGCGtGglarylaeryg.arvtGiDlseemlerareraa
00426821   1/1  elakrgg.kvtaieideemlelakenlkelg...nvefiqgDalkl.pfpdgkfDlivsN----------
00520841   1/1  lvefleallglpkggrvLdlGCGtGrdalwLaerGf.dVtGvDisetalelareraklaglvtrlgeleg
00479451   1/1  sklwldrsvydsyyfeakllglyrsraalkleelleklglkpgkrvLDlGCGtGglalylakrypgakvt
00415931   1/1  alAkltgakhvyGieiseealelakenakenkkrlklfglgidnvefiqgdaeel.plpdlgekfDvivs
00525101   1/1  ialaelgarkvyavDlsplalelcrknlallglddrvkvvhgdlldlldleessfDlill----------
00465681   1/1  LDlGcGpGgltlvlaervgpggrvvavDlsp.mlelar...........vefiqgdardl.plldlllel
00476561   1/1  alakklpalfpsigakvtgvDiseemielakerakelglsdnvnvefivgdaeellleqle---------
00505191   1/1  alaerg.grvigvDidpealalarerlaglgllnrvefvqgdalal.plpdgsfDgvlldlglsslgldr
00526181   1/1  galdalleilpellgllflldlllddellrelldllseidlseidydilgelyeyllgefaglrfklgef
00530871   1/1  alaerllpgarvvgvDidpealelaren..........eivvgDalellp..desfDliiaNPPyggsgd
00497781   1/1  qaAleyGakkvvGidispeaielakenlkelgkllelfgkklenrvefilgDf.ldlpfedlligsfDvv
00403271   1/1  alrflggmralsellldellealpdlsggkrvLDvGcGtGalllalakkyPga.kvtgvDlsp.mlelar
00369761   1/1  aaaklgr.rvigvdldpeavelarerlerng..vkievllgdaldll...dgsfdlvvanp---------
00478621   1/1  llaeaigvagkvlgvDidaevldlaednlkknglsllssgnvelvvgdllklile.dgkfDvvlsdpple
00490691   1/1  tlaLakrg.akvtavEidpdllellkerlkelg...nvevingdalkl.dlpdlllel------------
00423661   1/1  aalakalGageVtvvDisperleqaeelGadlvvvpseedlaeavreltgkqgggaDlvitaagipg...
00473031   1/1  lpgdlnleglrvLeiGcGtGaltlaLlkrlgakkvtavEidpdmi-------------------------


                         +         -         -         -         -         *         -:210
query           RAVLPKVRTGGVIVADNITRGPIDFGDLVAHFEDGAPLPDPEVDGETRGIGEYVGTVRSDEAVETAILPV
00521821   1/1  daplehlpdllellealrlLkpGGvlvldnvllpgavddp....................ealrellell
00494741   1/1  vefivgdaedflpfllaeglldgsfDlivsdalhpdlpklleelarlLkpGGrlvlsdplrpgeevllel
00520011   1/1  pdgkvvgiDispemlevar......glldnvtliqgdaldlpflekllelgsfDlvfidashshypvlld
00463541   1/1  pealelarenaerlgl.dnvefilgdaedllfe.dgsfDlvvsdapleh...lleellrlLkpGGrlvls
00484901   1/1  GcGtGglalalakllgpdarvt------------------------------------------------
00519301   1/1  lpetlleeflglrfkvdpgvffqtgl--------------------------------------------
00479231   1/1  hhlpdllkellrlLkpGGrl--------------------------------------------------
00518231   1/1  gerdllgelyenglrflvdpdgfgtglfptqella-----------------------------------
00475801   1/1  leellrlLkpGGrlvlvvgtleg.....................leellellkeagfevvevidpvgfvp
00499151   1/1  krpegarvtgvDispealelar------------------------------------------------
00507451   1/1  elllgelpeelyvqflglkfkvdpgvffrpgtel------------------------------------
00476761   1/1  tgvDispealelarenaaelgl.dnvefvvgda-------------------------------------
00491221   1/1  nvefivgDaed.lplpellledgsfDlvvsnfavl-----------------------------------
00495321   1/1  lellp.kpgkrvLDlGcGtGglalalakllpga.r-----------------------------------
00531071   1/1  flplllldekfDlivsn-----------------------------------------------------
00446891   1/1  keng...nvefivgDaeelpfp------------------------------------------------
00474711   1/1  pdarvtgvDispealelar---------------------------------------------------
00509191   1/1  lhhvpdleaflaeaarlLkPGGvlvistllgwde------------------------------------
00473291   1/1  avgpggrvvavDisp-------------------------------------------------------
00466961   1/1  plpdgsfDlvvsnpsgvlhhlpdeleallrelarvLk---------------------------------
00496711   1/1  glpnrvefvvgDaedl....dgsfDlvvsnavlh------------------------------------
00526491   1/1  wpgvlhhlpdellekllkel--------------------------------------------------
00509881   1/1  lakrgpaakvtgvDispea---------------------------------------------------
00467441   1/1  spealelarenaa..glpn.vefivgDaedpl--------------------------------------
00479191   1/1  edleallrelarvLkPGGrlvl------------------------------------------------
00518851   1/1  lllalldlkpgkrvLDlGcGt-------------------------------------------------
00531101   1/1  gkkgevldglrdlrellelalrllkpgGvl----------------------------------------
00498851   1/1  fgtglhpttelllellakllkpgdrVLDlGcGtG------------------------------------
00519441   1/1  ltlalaelvgpggrvvavDispealelarenaerlgl---------------------------------
00507621   1/1  .dgsfDlvvsnpnvlhhlppedlekllr------------------------------------------
00512611   1/1  lleelarlLkpGGrl-------------------------------------------------------
00511431   1/1  dpeallrelarvLkPGGrlvlstpnrpdleelrelldlle------------------------------
00516571   1/1  vrrpdpeaflreaarvLkPGGvlvlstlllagle------------------------------------
00390931   1/1  gplehlyteeflkecyrvLkpgGvlvvntispll------------------------------------
00528071   1/1  lhhlpdleallreaarvLkPGGrlvlstpsppgleellellra---------------------------
00469311   1/1  DlvvsnPpggvlhhlpd.leallrelarvLkPGGr-----------------------------------
00514491   1/1  sgvlhhlpdpllqeellkelarvLk---------------------------------------------
00502341   1/1  peallrelarvLkPGGrlvlstpnlpdlellrll------------------------------------
00430851   1/1  vpelgkdpggrvvgvDispea-------------------------------------------------
00450601   1/1  vgdaed.lpellfpdgsfDlvvsnfgvlhhlPpy------------------------------------
00415801   1/1  elllellg.lkpgkrvLDlGcGsGllaialaklg------------------------------------
00484381   1/1  vefivgDaedlldlplpdgsfDlvvsdlphlpdp------------------------------------
00511031   1/1  lalakrlga.rvtgvDispemlelarenaaelgl...vefiv----------------------------
00414441   1/1  peallrelarvLkpGGrlvlseptlegeepeelldfi---------------------------------
00445501   1/1  lprlrellsrldeltkegllrllllrsgelllllvdkpld------------------------------
00509351   1/1  ak.vtgvDispemlef------------------------------------------------------
00478511   1/1  fivgdaedl....dgsfDlvvsngvlehlllegg------------------------------------
00473861   1/1  p.lpd.fDlvvsnavlhhlpdpdleallrelarvLkpGGrlvlsepnlpdleellelllelllellpllg
00491711   1/1  pedleaalreiarvLkPGGrlvlstpnpddllellellrflerlylllfglle-----------------
00490741   1/1  elarenaaelglspnvefvvgDaed...plpds-------------------------------------
00527391   1/1  viqgdaleflpelge-------------------------------------------------------
00527491   1/1  kaalkllkpggivyv-------------------------------------------------------
00501541   1/1  hhlpdedleallrelarvLkPGGrlvlstpnrpdllsleelee---------------------------
00486291   1/1  plpdekfDlvvsnpvlhhlp--------------------------------------------------
00518841   1/1  arlvgpkGrVigvdiseem---------------------------------------------------
00532291   1/1  pdealyteefleelk-------------------------------------------------------
00497191   1/1  pgak.vtgvDi.pemlelarenakelglpnrvefivgDaed...plpdgfDlivssgvlhhlpdpelekl
00409641   1/1  hgaaevtgvdidpevielake-------------------------------------------------
00516171   1/1  leavlaelarvLkp--------------------------------------------------------
00518401   1/1  rknlkrlglpkrvrlvvgdalda-----------------------------------------------
00506931   1/1  alpgesfDlvvldP--------------------------------------------------------
00530771   1/1  dleallaelarvLkpGGrlllstpnrldlrkglp------------------------------------
00468381   1/1  efvvgDaedplp....sfDlvvsngvlhhlpdpeleallrelarvLkPGGrlvlsepvrpdleelrllll
00408291   1/1  slgllifvlhhl.edleefleealrvLkpgGrlvlvtfss..ledeivkkllkelgklvlvvkgpll---
00507491   1/1  e.lp...gkfDlvvs-------------------------------------------------------
00379821   1/1  sfDvilsdaplshlpde..aleealrvLkpGGrlvisdfsrsidspeeneevfeellk------------
00502421   1/1  hhlpd..peallrelarvLkPGGrlvlsepnrpsleelllllllllllllp..............hgrfl
00494421   1/1  lelarenaelngl..-------------------------------------------------------
00401961   1/1  areraaelglpnrvefvqgdaed.lp..d.sfDlvvsnevlhhlgpedleaalkelarvLkpGGrlvlst
00487741   1/1  raalhalppedrery-------------------------------------------------------
00421971   1/1  DispemlelArera......gnvefivgdaed.lpfpdgsfDl---------------------------
00468401   1/1  nvefvvgDaedplp....sfDlvvsngvlhhlpdpeleallrelarvLkpGgelGrll------------
00488051   1/1  pfpdgsfDvvlsdavlh...pd------------------------------------------------
00413261   1/1  dilllevldleplsallehldd.leelleeaarl------------------------------------
00526931   1/1  llyllllllalkllk-------------------------------------------------------
00472111   1/1  llradrvrfvvgdaedlppllalplpdgsfDavvssfvlhhvppdlpdleralrelarlLrPGGrlllve
00350261   1/1  elrdrveflqgdlldlpppldgs-----------------------------------------------
00474651   1/1  drVLDlGcGsGglalalaklvgpagrvvavDispeal---------------------------------
00366101   1/1  ppyllgledleklleeaarlLk------------------------------------------------
00516791   1/1  vvgdaed.lplpdellgsfDlvvssfv.lehvce------------------------------------
00451091   1/1  ehlpdl.eelrrlvlmlqlee-------------------------------------------------
00525361   1/1  gsfDlivssevlhhlsdedlaaflrelrrvLkPgGllvisdp----------------------------
00518421   1/1  hl.pdpeaalrelarvLkPGGrlvlstpnresl-------------------------------------
00512391   1/1  fDlvvsnfnvlhhllseedlekalkeiarvLkpg------------------------------------
00527091   1/1  eaglsnrvefivgdaed.lp...gsfDlvvsi--------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00520841   1/1  gklflysgpnitfvqgdlfdlpfapdgsfDlvyd------------------------------------
00479451   1/1  gvDispemlelaren.krlgl.dnvefiqgvda.------------------------------------
00415931   1/1  npplhipdleevlkeilrvLkpGGrivildpivplrfplnsrrledlfdilevkkleflegsvswtgpeg
00525101   1/1  ----------------------------------------------------------------------
00465681   1/1  lpdgsfDlvlsdap--------------------------------------------------------
00476561   1/1  ----------------------------------------------------------------------
00505191   1/1  adndeledlaealee-------------------------------------------------------
00526181   1/1  ytprpvtellvelll-------------------------------------------------------
00530871   1/1  ldrlldellkrlyde-------------------------------------------------------
00497781   1/1  fsnnllfdpdllkal-------------------------------------------------------
00403271   1/1  en.......prvefvvgDafdplp....s-----------------------------------------
00369761   1/1  ----------------------------------------------------------------------
00478621   1/1  hi...leeiarlLkP-------------------------------------------------------
00490691   1/1  ----------------------------------------------------------------------
00423661   1/1  vlrealevmkpggvvvdvaidqgeltlplttl--------------------------------------
00473031   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GSGIAVSTKVE-----------------------------------------------------------
00521821   1/1  redpgletv-------------------------------------------------------------
00494741   1/1  ldalfil....-----------------------------------------------------------
00520011   1/1  lllrlLkp--------------------------------------------------------------
00463541   1/1  tille-----------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00475801   1/1  ltdglel---------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00531101   1/1  ----------------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00450601   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00473861   1/1  l---------------------------------------------------------------------
00491711   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00527391   1/1  ----------------------------------------------------------------------
00527491   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00532291   1/1  ----------------------------------------------------------------------
00497191   1/1  l---------------------------------------------------------------------
00409641   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00506931   1/1  ----------------------------------------------------------------------
00530771   1/1  ----------------------------------------------------------------------
00468381   1/1  l---------------------------------------------------------------------
00408291   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00502421   1/1  s---------------------------------------------------------------------
00494421   1/1  ----------------------------------------------------------------------
00401961   1/1  inledlee.-------------------------------------------------------------
00487741   1/1  ----------------------------------------------------------------------
00421971   1/1  ----------------------------------------------------------------------
00468401   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00526931   1/1  ----------------------------------------------------------------------
00472111   1/1  p---------------------------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00474651   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00516791   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00525361   1/1  ----------------------------------------------------------------------
00518421   1/1  ----------------------------------------------------------------------
00512391   1/1  ----------------------------------------------------------------------
00527091   1/1  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00520841   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00415931   1/1  vfy-------------------------------------------------------------------
00525101   1/1  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00476561   1/1  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00497781   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00369761   1/1  ----------------------------------------------------------------------
00478621   1/1  ----------------------------------------------------------------------
00490691   1/1  ----------------------------------------------------------------------
00423661   1/1  ----------------------------------------------------------------------
00473031   1/1  ----------------------------------------------------------------------