[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for hlac0:ACM57250.1


[Show Plain Result]

## Summary of Sequence Search
   1::293
   4::265  9.3e-47 35.2% 0036450 00364501 1/1   ouridine synthase                       
   1::293


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDASAATRAFRVAYDGREYAGFQRQPHATTVEGTLLRALAKHGILDRGDGPTHATPPGYAAAGRTDAGV
00364501   1/1  ---lkmrrialliaYdGtnylGwqrqpnlrtvqgelekallkllli..........kvslvragRTDkGV


                         -         -         *         -         -         -         -:140
query           SAVAQTVAFEAPDWLTPRAFNGHLPGSVRVWAAADVPAGFHATHDAVRRTYRYHLYAPARVEETDHDHAV
00364501   1/1  hAlgqvvhfdlpldldleklllalnsllpddirvlsvalvpddFharfsalsRtYrYlllnrallspllr


                         +         -         -         -         -         *         -:210
query           DDGRVRDALARLSGEQDFHNLTSDETGTVRDLTTTATREGDILVVEVSAGGFPRALVRRLVAAVRAVGRG
00364501   1/1  glvlhvlspldleamneaaklllGthdFsnFtkaglqvkstvrtilslevlrdgdllvieivgnsFLlhq


                         -         -         -         +         -         -         -:280
query           TADPSLIDRLLASEPISGEFGIGPAPPEPLVLWDVSYEGVAFEVDPEAAESARVAFGERYRDARHAAAAT
00364501   1/1  vRllvgllllvgrgllslelikelleakdr..klaiptapalgLyLvdvlYpdyl---------------


                         -         *         -         -         -         -         +:350
query           GAIRDRIAGTDQS---------------------------------------------------------
00364501   1/1  ----------------------------------------------------------------------