[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for huge0:KIAA0059


[Show Plain Result]

## Summary of Sequence Search
   1::724
  45::99   PF00412 0.0% 32.7272727272727  LIM domain 
 104::155  PF00412 0.0% 29.4117647058824  LIM domain 
 172::225  PF00412 0.0% 46.2962962962963  LIM domain 
 231::273  PF00412 0.0% 33.3333333333333  LIM domain 
 276::295  PF00412 0.0% 20  LIM domain 
 689::724  PF02209 0.0% 50  Villin headpiece domain 
   1::724


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           NPGALCMLMTLEMTELTDPHHTMGDYKVAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHIKCFT
PF00412         --------------------------------------------CagCnkkiadrelvlkaldkvyHeeC
PF00412         --------------------------------------------CagCnkkiadrelvlkaldkvyHeeC
PF00412         --------------------------------------------CagCnkkiadrelvlkaldkvyHeeC
PF00412         --------------------------------------------CagCnkkiadrelvlkaldkvyHeeC
PF00412         --------------------------------------------CagCnkkiadrelvlkaldkvyHeeC
PF02209         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           CKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPG
PF00412         FtCseCqkplkeksffekdgklyCkkdyl----CagCnkkiadrelvlkaldkvyHeeCFtCseCqkplk
PF00412         FtCseCqkplkeksffekdgklyCkkdyl----CagCnkkiadrelvlkaldkvyHeeCFtCseCqkplk
PF00412         FtCseCqkplkeksffekdgklyCkkdyl----CagCnkkiadrelvlkaldkvyHeeCFtCseCqkplk
PF00412         FtCseCqkplkeksffekdgklyCkkdyl----CagCnkkiadrelvlkaldkvyHeeCFtCseCqkplk
PF00412         FtCseCqkplkeksffekdgklyCkkdyl----CagCnkkiadrelvlkaldkvyHeeCFtCseCqkplk
PF02209         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DRVTFNGRDCLCQLCAQPMSSSPKETTFSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVLTGEY
PF00412         eksffekdg.klyCk----------------CagCnkkiadrelvlkaldkvyHeeCFtCseCqkplkek
PF00412         eksffekdg.klyCk----------------CagCnkkiadrelvlkaldkvyHeeCFtCseCqkplkek
PF00412         eksffekdg.klyCk----------------CagCnkkiadrelvlkaldkvyHeeCFtCseCqkplkek
PF00412         eksffekdg.klyCk----------------CagCnkkiadrelvlkaldkvyHeeCFtCseCqkplkek
PF00412         eksffekdg.klyCk----------------CagCnkkiadrelvlkaldkvyHeeCFtCseCqkplkek
PF02209         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHP
PF00412         sffekdgklyCkkdy-----CagCnkkiadrelvlkaldkvyHeeCFtCseCqkplkeks.ff--kvyHe
PF00412         sffekdgklyCkkdy-----CagCnkkiadrelvlkaldkvyHeeCFtCseCqkplkeks.ff--kvyHe
PF00412         sffekdgklyCkkdy-----CagCnkkiadrelvlkaldkvyHeeCFtCseCqkplkeks.ff--kvyHe
PF00412         sffekdgklyCkkdy-----CagCnkkiadrelvlkaldkvyHeeCFtCseCqkplkeks.ff--kvyHe
PF00412         sffekdgklyCkkdy-----CagCnkkiadrelvlkaldkvyHeeCFtCseCqkplkeks.ff--kvyHe
PF02209         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DCKQSTKTEEKLRPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLI
PF00412         eCFtCseCqkplkek-------------------------------------------------------
PF00412         eCFtCseCqkplkek-------------------------------------------------------
PF00412         eCFtCseCqkplkek-------------------------------------------------------
PF00412         eCFtCseCqkplkek-------------------------------------------------------
PF00412         eCFtCseCqkplkek-------------------------------------------------------
PF02209         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           TYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSP
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF02209         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           QHFHRPGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHAALAAQSKSSEDI
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF02209         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           IKFSKFPAAQAPDPSETPEIETDHWPGPPSFAVIGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGL
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF02209         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           GQLILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGG
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF02209         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           VRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFG
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF02209         ----------------------------------------------------------YLsdedFeevFg


                         -         -         -         -         +         -         -:770
query           MSIQEFDRLPLWRRNDMKKKAKLF----------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF02209         MtkeeFykLPaWKqnqlKkklgLF----------------------------------------------