[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for huge0:KIAA1268


[Show Plain Result]

## Summary of Sequence Search
   1::1023
 163::279  PF01661 0.0% 40.1709401709402  Macro domain 
 387::490  PF01661 0.0% 31.3725490196078  Macro domain 
 588::689  PF01661 0.0% 27.4509803921569  Macro domain 
 879::929  PF02825 0.0% 25.4901960784314  WWE domain 
   1::1023


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           YKLLFNFVEQNMKIERLVEVKPSLVIDYLKTEKKLFWPKIKKVNVQVSFNPENKQKGILLTGSKTEVLKA
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF02825         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VDIVKQVWDSVCVKSVHTDKPGAKQFFQDKARFYQSEIKRLFGCYIELQENEVMKEGGSPAGQKCFSRTV
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF02825         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LAPGVVLIVQQGDLARLPVDVVVNASNEDLKHYGGLAAALSKAAGPELQADCDQIVKREGRLLPGNATIS
PF01661         ----------------------VNAaNsnllgggGvagaihraagkalkeeckelekkqggillGeavvt
PF01661         ----------------------VNAaNsnllgggGvagaihraagkalkeeckelekkqggillGeavvt
PF01661         ----------------------VNAaNsnllgggGvagaihraagkalkeeckelekkqggillGeavvt
PF02825         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRAVQLSLCLAEKYKYRSIAIPAISSGVFGFPLGRCVETI
PF01661         paynlpakyvihavgplftsskskeeeellasayknalelaeekgiksvafPaistGifgvpweeaaev-
PF01661         paynlpakyvihavgplftsskskeeeellasayknalelaeekgiksvafPaistGifgvpweeaaev-
PF01661         paynlpakyvihavgplftsskskeeeellasayknalelaeekgiksvafPaistGifgvpweeaaev-
PF02825         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VSAIKENFQFKKDGHCLKEIYLVDVSEKTVEAFAEAVKTVFKATLPDTAAPPGLPPAAAGPGKTSWEKGS
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF02825         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LVSPGGLQMLLVKEGVQNAKTDVVVNSVPLDLVLSRGPLSKSLLEKAGPELQEELDTVGQGVAVSMGTVL
PF01661         ------------------------------------gGvagaihraagkalkeeckelekkqgg..illG
PF01661         ------------------------------------gGvagaihraagkalkeeckelekkqgg..illG
PF01661         ------------------------------------gGvagaihraagkalkeeckelekkqgg..illG
PF02825         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           KTSSWNLDCRYVLHVVAPEWRNGSTSSLKIMEDIIRECMEITESLSLKSIAFPAIGTGNLGFPKNIFAEL
PF01661         eavvtpaynlpakyvihavgplftsskskeeeellasayknalelaeekgiksvafPaistGifgvpwee
PF01661         eavvtpaynlpakyvihavgplftsskskeeeellasayknalelaeekgiksvafPaistGifgvpwee
PF01661         eavvtpaynlpakyvihavgplftsskskeeeellasayknalelaeekgiksvafPaistGifgvpwee
PF02825         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           IISEVFKFSSKNQLKTLQEVHFLLHPSDHENIQAFSDEFARRANGNLVSDKIPKAKDTQGFYGTVSSPDS
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF02825         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           GVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSKAILECAGQNVERECSQQAQQRKNDYII
PF01661         ---------------------------VNAaNsnllgggGvagaihraagkalkeeckelekkqggillG
PF01661         ---------------------------VNAaNsnllgggGvagaihraagkalkeeckelekkqggillG
PF01661         ---------------------------VNAaNsnllgggGvagaihraagkalkeeckelekkqggillG
PF02825         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           TGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPAIGTGNAKQHPDKVAEAIIDAIEDFVQK
PF01661         eavvtpaynlpakyvihavgplftsskskeeeellasayknalelaeekgiksvafPai-----------
PF01661         eavvtpaynlpakyvihavgplftsskskeeeellasayknalelaeekgiksvafPai-----------
PF01661         eavvtpaynlpakyvihavgplftsskskeeeellasayknalelaeekgiksvafPai-----------
PF02825         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           GSAQSVKKVKVVIFLPQVLDVFYANMKKREGTQLSSQQSVMSKLASFLGFSKQSPQKKNHLVLEKKTESA
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF02825         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           TFRVCGENVTCVEYAISWLQDLIEKEQCPYTSEDECIKDFDEKEYQELNELQKKLNINISLDHKRPLIKV
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF02825         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           LGISRDVMQARDEIEAMIKRVRLAKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTV
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF02825         --------------------------------------vWeyedsngkWrpYspavsehIenayaakert


                         -         -         -         +         -         -         -:980
query           DVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFN
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF02825         levdifgrpytidfksmtq---------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           QTCSHFRIEKVSLLLECSFWMVEISSVMVLYKIHFHSLPITFF---------------------------
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF01661         ----------------------------------------------------------------------
PF02825         ----------------------------------------------------------------------