[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for huge0:KIAA1464


[Show Plain Result]

## Summary of Sequence Search
   1::621
 102::222  PF00622 0.0% 31.3559322033898  SPRY domain 
 509::616  PF10607 0.0% 28.7128712871287  Ran binding protein in the microtubule-organising c 
 258::280  PF08513 0.0% 47.8260869565217 PF08513 LisH 
   1::621


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           KMAAATADPGAGNPQPGDSSGGGAGGGLPSPGEQELSRRLQRLYPAVNQQETPLPRSWSPKDKYNYIGLS
PF00622         ----------------------------------------------------------------------
PF10607         ----------------------------------------------------------------------
PF08513         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHS
PF00622         -------------------------------gkhyfevevddgge.shirvGwatkeaesrkgeenllge
PF10607         ----------------------------------------------------------------------
PF08513         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           YGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTCFYTKNGHSLGIAFTDLPANLYPTVGLQTP
PF00622         degswgldlskgskyhavts.eetgeklqeegdviGvllDleggeisFtkngkhlgiyafrnvefgealf
PF10607         ----------------------------------------------------------------------
PF08513         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GEIVDANFGQQPFLFDIEDYMREWRAKVQGTVHCFPISARLGEWQAVLQNMVSSYLVHHGYCATATAFAR
PF00622         Pavslka.gnai----------------------------------------------------------
PF10607         ----------------------------------------------------------------------
PF08513         -----------------------------------------------LNrLIydYLvksGyketAeaFak


                         -         *         -         -         -         -         +:350
query           MTETPIQEEQASIKNRQKIQKLVLEGRVGEAIETTQRFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVR
PF00622         ----------------------------------------------------------------------
PF10607         ----------------------------------------------------------------------
PF08513         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SLSSRSPKSQDSYPGSPSLSPRHGPSSSHMHNTGADSPSCSNGVASTKSKQNHSKYPAPSSSSSSSSSSS
PF00622         ----------------------------------------------------------------------
PF10607         ----------------------------------------------------------------------
PF08513         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SSSPSSVNYSESNSTDSTKSQHHSSTSNQETSDSEMEMEAEHYPNGVLGSMSTRIVNGAYKHEDLQTDES
PF00622         ----------------------------------------------------------------------
PF10607         ----------------------------------------------------------------------
PF08513         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           SMDDRHPRRQLCGGNQAATERIILFGRELQALSEQLGREYGKNLAHTEMLQDAFSLLAYSDPWSCPVGQQ
PF00622         ----------------------------------------------------------------------
PF10607         ------------------leealeFaqeklapkaaen......pellkeLektmaLLafedpessksplr
PF08513         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           LDPIQREPVCAALNSAILESQNLPKQPPLMLALGQASECLRLMARAGLGSCSFARVDDYLH---------
PF00622         ----------------------------------------------------------------------
PF10607         alldlsqRekvakevNaaILesqgkekeskleklvkqlawaeeklrekg.kspkll--------------
PF08513         ----------------------------------------------------------------------