[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for huge0:KIAA1520


[Show Plain Result]

## Summary of Sequence Search
   1::810
 234::495  PF00664 0.0% 29.2307692307692  ABC transporter transmembrane region 
 590::715  PF00005 0.0% 29.4642857142857  ABC transporter 
 577::594  PF02463 0.0% 55.5555555555556  RecF/RecN/SMC N terminal domain 
 686::755  PF02463 0.0% 30  RecF/RecN/SMC N terminal domain 
 562::599  PF03193 0.0% 37.8378378378378  Protein of unknown function, DUF258 
   1::810


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           ARHYHSGSPAPGPGPAWPRPVDDDGLAPVSYNLAFSTRPPPTSRMRLWKAVVVTLAFMSVDICVTTAIYV
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FSHLDRSLLEDIRHFNIFDSVLDLWAACLYRSCLLLGATIGVAKNSALGPRRLRASWLVITLVCLFVGIY
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AMVKLLLFSEVRRPIRDPWFWALFVWTYISLGASFLLWWLLSTVRPGTQALEPGAATEAEGFPGSGRPPP
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EQASGATLQKLLSYTKPDVAFLVAASFFLIVAALGETFLPYYTGRAIDGIVIQKSMDQFSTAVVIVCLLA
PF00664         -----------------------lailllilagvtalvfplllgrllds.vsdgnde.ersslyslaill
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IGSSFAAGIRGGIFTLIFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLVSQNINV
PF00664         iavgvlivlllqgsfyllertgqrirkrlfrallrkilglfdsffdknsvGellsrltnDvskirdglgd
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           FLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQNALARASNTAEETISAMK
PF00664         klglffqslatfvgglivmfylgwkltlvllailpllilvsavlakilkslqkkeqkayakagavaeEal
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           TVRSFANEEEEAEVYLRKLQQVYKLNRKEAAAYMYYVWGSGLTLLVVQVSILYYGGHLVISGQMTSGNLI
PF00664         sgirtVkafggeekeleryekaleeakkagikkaitagllfgftqlisylsyalalwfgtflsvisgels
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           AFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTR
PF00664         vgtvf-----------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           PHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHRVISLVS
PF00664         ----------------------------------------------------------------------
PF00005         -----------------------------STLlklltgelkptegeievdndrkdlesdkleklr..igy
PF02463         ----------------sftaivGpNGSGKsnvld------------------------------------
PF02463         ----------------sftaivGpNGSGKsnvld------------------------------------
PF03193         -tkegleelaellkd.ktsvlvGqSGvGKSsLinallpe-------------------------------


                         -         +         -         -         -         -         *:700
query           QEPVLFARSITDNISYGLPTVPFEMVVEAAQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARA
PF00664         ----------------------------------------------------------------------
PF00005         ipqdpllfpeltvrenldmakeekk..tdkrieevlekvgldelldk..........srvstLSgGqkqr
PF02463         -------------------------------------------------------lLSgGektLvalaLl
PF02463         -------------------------------------------------------lLSgGektLvalaLl
PF03193         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           LVRNPPVLILDEATSALDAESEYLIQQAIHGNLQKHTVLIIAHRLSTVEHAHLIVVLDKGRVVQQGTHQQ
PF00664         ----------------------------------------------------------------------
PF00005         valArallkkpklll-------------------------------------------------------
PF02463         fAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivislreemleka---------------
PF02463         fAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivislreemleka---------------
PF03193         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LLAQGGLYAKLVQRQMLGLQPAADFTAGHNEPVANGSHKA------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------